|
|
Available sections:
ATGAGTCATAAAGATTTTAATGGGCTTCAAGCCCCTCAGTTGTTAAGTTCGAGTTCCCCTGTTGCAAAGAAACAAAGTAG TCATAAACTCAGGCATGCCTTAAAGCACGCCCGTTACTTAAACCATAGTAGTAAGCGTACCCTCAAGCATGCCTTAGAGC TGCATGAAGACAACCAGGTCTTACTGGAAAAAGAAGGTAGTCCTAACTTCCAGGACTGGCTTTCTAAGCAACCTGGGGTC AATAAAACCAGCCTTAAGTACAACAAAAGCTTGGGTAGTTGAATCTCTAAGGAAAGTAAACCGAAAAAGCGTTTTCCACC GTACTTTACGTACAAGGGCAGTAAAACTACTCCAGAAGAGGCCAAAGCCTTGCAGCAAATGAAACAATCCCAAAAGCGCT TCTTTCACGAAAATATGCACAGCTTTCTCAATGAAGTTGCACATAACCCAATGATCCAGCGCTTTAAGCAAAAGCAGGCC AAACGGGCTGCTAATACGCGACAACGCACTTACAAATACCGTCAGTAA
(176 codons) fields: [triplet] [frequency: per thousand] ([number]) UUU34.1( 6) UCU11.4( 2) UAU0.0( 0) UGU0.0( 0) UUC11.4( 2) UCC11.4( 2) UAC34.1( 6) UGC0.0( 0) UUA28.4( 5) UCA0.0( 0) UAA5.7( 1) UGA5.7( 1) UUG17.0( 3) UCG5.7( 1) UAG0.0( 0) UGG5.7( 1) CUU17.0( 3) CCU22.7( 4) CAU39.8( 7) CGU22.7( 4) CUC17.0( 3) CCC0.0( 0) CAC17.0( 3) CGC17.0( 3) CUA0.0( 0) CCA17.0( 3) CAA45.5( 8) CGA5.7( 1) CUG11.4( 2) CCG11.4( 2) CAG39.8( 7) CGG5.7( 1) AUU0.0( 0) ACU17.0( 3) AAU28.4( 5) AGU62.5( 11) AUC11.4( 2) ACC11.4( 2) AAC28.4( 5) AGC17.0( 3) AUA0.0( 0) ACA0.0( 0) AAA73.9( 13) AGA0.0( 0) AUG22.7( 4) ACG11.4( 2) AAG68.2( 12) AGG5.7( 1) GUU11.4( 2) GCU11.4( 2) GAU5.7( 1) GGU11.4( 2) GUC11.4( 2) GCC39.8( 7) GAC11.4( 2) GGC5.7( 1) GUA0.0( 0) GCA11.4( 2) GAA39.8( 7) GGA0.0( 0) GUG0.0( 0) GCG0.0( 0) GAG11.4( 2) GGG11.4( 2)
Note: This was generated using the standard codon usage table; UGA codons in MP/MP genes will show up as terminators ("*")
atgagtcataaagattttaatgggcttcaagcccctcagttgttaagttcgagttcccct M S H K D F N G L Q A P Q L L S S S S P gttgcaaagaaacaaagtagtcataaactcaggcatgccttaaagcacgcccgttactta V A K K Q S S H K L R H A L K H A R Y L aaccatagtagtaagcgtaccctcaagcatgccttagagctgcatgaagacaaccaggtc N H S S K R T L K H A L E L H E D N Q V ttactggaaaaagaaggtagtcctaacttccaggactggctttctaagcaacctggggtc L L E K E G S P N F Q D W L S K Q P G V aataaaaccagccttaagtacaacaaaagcttgggtagttgaatctctaaggaaagtaaa N K T S L K Y N K S L G S * I S K E S K ccgaaaaagcgttttccaccgtactttacgtacaagggcagtaaaactactccagaagag P K K R F P P Y F T Y K G S K T T P E E gccaaagccttgcagcaaatgaaacaatcccaaaagcgcttctttcacgaaaatatgcac A K A L Q Q M K Q S Q K R F F H E N M H agctttctcaatgaagttgcacataacccaatgatccagcgctttaagcaaaagcaggcc S F L N E V A H N P M I Q R F K Q K Q A aaacgggctgctaatacgcgacaacgcacttacaaataccgtcagtaa K R A A N T R Q R T Y K Y R Q *
MSHKDFNGLQAPQLLSSSSPVAKKQSSHKLRHALKHARYLNHSSKRTLKHALELHEDNQVLLEKEGSPNFQDWLSKQPGV NKTSLKYNKSLGSWISKESKPKKRFPPYFTYKGSKTTPEEAKALQQMKQSQKRFFHENMHSFLNEVAHNPMIQRFKQKQA KRAANTRQRTYKYRQ
This information was obtained using the Protein Parameters tool on the ExPASy Molecular Biology Server.
Number of amino acids: 175
Molecular weight: 20516.4
Theoretical pI: 10.37
Amino acid composition:
Ala (A) 11 6.3%
Arg (R) 10 5.7%
Asn (N) 10 5.7%
Asp (D) 3 1.7%
Cys (C) 0 0.0%
Gln (Q) 15 8.6%
Glu (E) 9 5.1%
Gly (G) 5 2.9%
His (H) 10 5.7%
Ile (I) 2 1.1%
Leu (L) 16 9.1%
Lys (K) 25 14.3%
Met (M) 4 2.3%
Phe (F) 8 4.6%
Pro (P) 9 5.1%
Ser (S) 19 10.9%
Thr (T) 7 4.0%
Trp (W) 2 1.1%
Tyr (Y) 6 3.4%
Val (V) 4 2.3%
Asx (B) 0 0.0%
Glx (Z) 0 0.0%
Xaa (X) 0 0.0%
Total number of negatively charged residues (Asp + Glu): 12
Total number of positively charged residues (Arg + Lys): 35
Atomic composition:
Carbon C 911
Hydrogen H 1443
Nitrogen N 277
Oxygen O 257
Sulfur S 4
Formula: C911H1443N277O257S4
Total number of atoms: 2892
Extinction coefficients:
Conditions: 6.0 M guanidium hydrochloride
0.02 M phosphate buffer
pH 6.5
Extinction coefficients are in units of M-1 cm-1 .
276 278 279 280 282
nm nm nm nm nm
Ext. coefficient 19500 19600 19390 19060 18400
Abs 0.1% (=1 g/l) 0.950 0.955 0.945 0.929 0.897
Estimated half-life:
The N-terminal of the sequence considered is M (Met).
The estimated half-life is: 30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Instability index:
The instability index (II) is computed to be 66.36
This classifies the protein as unstable.
Aliphatic index: 53.03
Grand average of hydropathicity (GRAVY): -1.221| Model | Percentage of MP Gene |
|---|---|
| Coiled Coil (CCP) | 0 |
| Disordered (SEG) | 8 |
| Transmembrane (PHDhtm) | 0 |
| Transmembrane (TMHMM) | 0 |
| Homologous to known structure (PSIBLAST) | 0 |
Sequence: Amino acid sequence.
CCP (C or -): coiled coil prediction from the ccp program (NCBI toolkit)
SEG (D or -): low complexity regions (possibly disordered) from SEG
PHDhtm (H or -): Transmembrane prediction from PHDhtm
TMHMM (H or -): Transmembrane prediction from TMHMM
PSIBLAST (3 or -): Regions potentially homologous to a protein of known 3D structure, according to PSIBLAST
Pred2ary (H, E, or -): Secondary structure prediction from Pred2ary
10 20 30 40 50 60 70 80
| | | | | | | |
Sequence MSHKDFNGLQAPQLLSSSSPVAKKQSSHKLRHALKHARYLNHSSKRTLKHALELHEDNQVLLEKEGSPNFQDWLSKQPGV
CCP --------------------------------------------------------------------------------
SEG -------------DDDDDDDDDDDDDD-----------------------------------------------------
PHDhtm --------------------------------------------------------------------------------
TMHMM --------------------------------------------------------------------------------
PSIBLAST --------------------------------------------------------------------------------
Pred2ary ---------------------------HHHHHHHHHHHH------HHHHHHH-------EEEE-----------------
90 100 110 120 130 140 150 160
| | | | | | | |
Sequence NKTSLKYNKSLGSWISKESKPKKRFPPYFTYKGSKTTPEEAKALQQMKQSQKRFFHENMHSFLNEVAHNPMIQRFKQKQA
CCP --------------------------------------------------------------------------------
SEG --------------------------------------------------------------------------------
PHDhtm --------------------------------------------------------------------------------
TMHMM --------------------------------------------------------------------------------
PSIBLAST --------------------------------------------------------------------------------
Pred2ary --EEEEE---------HHHHH-------E---------HHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHHHHHHHHHH
170
|
Sequence KRAANTRQRTYKYRQ
CCP ---------------
SEG ---------------
PHDhtm ---------------
TMHMM ---------------
PSIBLAST ---------------
Pred2ary HHHHHHHHHHHH---