Berkeley Structural Genomics Center

Info for MP122

This gene is gi number 1673781 from Mycoplasma pneumonia.

Available sections:


Potential Target Homologues of MP122

Targetlog10(PSIBLAST E)% identical% coverage (of MP gene)Latest Status
1021B-17.7028.7052.68Override suggest work stop (low sequencial homology to the known structures)
1022B-14.7025.7163.25In PDB (1G2I)

Back to Top


MP122 DNA sequence

ATGAAAAAACTCTTAGTCATTGTTTACCCTGACATGAATGATGTGGAATACACCAACACAATGGTGGTATTTGGTTTTGT
TAAAGAATTACAAACCGTGATTTATCACCCTAACTTAAGTACAGTTAAGGGCAGTAATGGGGTAACTTTAGTAAACCAGA
TTACTAGCAAGGTTAATCTGGAGGAATTTGATGGTGTCTTTATCCCTGGCGGTATGGGAGCTACCAAGGTATTAGACCAT
GACCAACAGTTACTCGACACTATCCGTTACTTTAAGGATCATGACAAGTATGTCTTTGCCATTTGTGATACCCCCAACGT
GTTGTAA

Back to Top


MP122 Codon Usage

(109 codons)
fields: [triplet] [frequency: per thousand] ([number])

UUU55.0(   6)  UCU0.0(   0)  UAU18.3(   2)  UGU9.2(   1)  
UUC0.0(   0)  UCC0.0(   0)  UAC27.5(   3)  UGC0.0(   0)  
UUA55.0(   6)  UCA0.0(   0)  UAA9.2(   1)  UGA0.0(   0)  
UUG9.2(   1)  UCG0.0(   0)  UAG0.0(   0)  UGG0.0(   0)  

CUU0.0(   0)  CCU27.5(   3)  CAU18.3(   2)  CGU9.2(   1)  
CUC18.3(   2)  CCC9.2(   1)  CAC9.2(   1)  CGC0.0(   0)  
CUA0.0(   0)  CCA0.0(   0)  CAA18.3(   2)  CGA0.0(   0)  
CUG9.2(   1)  CCG0.0(   0)  CAG18.3(   2)  CGG0.0(   0)  

AUU36.7(   4)  ACU27.5(   3)  AAU27.5(   3)  AGU18.3(   2)  
AUC18.3(   2)  ACC36.7(   4)  AAC36.7(   4)  AGC9.2(   1)  
AUA0.0(   0)  ACA18.3(   2)  AAA27.5(   3)  AGA0.0(   0)  
AUG36.7(   4)  ACG0.0(   0)  AAG45.9(   5)  AGG0.0(   0)  

GUU36.7(   4)  GCU9.2(   1)  GAU36.7(   4)  GGU27.5(   3)  
GUC27.5(   3)  GCC9.2(   1)  GAC45.9(   5)  GGC18.3(   2)  
GUA36.7(   4)  GCA0.0(   0)  GAA27.5(   3)  GGA9.2(   1)  
GUG36.7(   4)  GCG0.0(   0)  GAG9.2(   1)  GGG9.2(   1)  

Back to Top


MP122 Translation

Note: This was generated using the standard codon usage table; UGA codons in MP/MP genes will show up as terminators ("*")

atgaaaaaactcttagtcattgtttaccctgacatgaatgatgtggaatacaccaacaca
 M  K  K  L  L  V  I  V  Y  P  D  M  N  D  V  E  Y  T  N  T 
atggtggtatttggttttgttaaagaattacaaaccgtgatttatcaccctaacttaagt
 M  V  V  F  G  F  V  K  E  L  Q  T  V  I  Y  H  P  N  L  S 
acagttaagggcagtaatggggtaactttagtaaaccagattactagcaaggttaatctg
 T  V  K  G  S  N  G  V  T  L  V  N  Q  I  T  S  K  V  N  L 
gaggaatttgatggtgtctttatccctggcggtatgggagctaccaaggtattagaccat
 E  E  F  D  G  V  F  I  P  G  G  M  G  A  T  K  V  L  D  H 
gaccaacagttactcgacactatccgttactttaaggatcatgacaagtatgtctttgcc
 D  Q  Q  L  L  D  T  I  R  Y  F  K  D  H  D  K  Y  V  F  A 
atttgtgatacccccaacgtgttgtaa
 I  C  D  T  P  N  V  L  * 

Back to Top


MP122 AA Sequence

MKKLLVIVYPDMNDVEYTNTMVVFGFVKELQTVIYHPNLSTVKGSNGVTLVNQITSKVNLEEFDGVFIPGGMGATKVLDH
DQQLLDTIRYFKDHDKYVFAICDTPNVL

Back to Top


MP122 Protein Parameters

This information was obtained using the Protein Parameters tool on the ExPASy Molecular Biology Server.

Number of amino acids: 108

Molecular weight: 12200.0

Theoretical pI: 5.14

Amino acid composition:

Ala (A)   2	  1.9%
Arg (R)   1	  0.9%
Asn (N)   7	  6.5%
Asp (D)   9	  8.3%
Cys (C)   1	  0.9%
Gln (Q)   4	  3.7%
Glu (E)   4	  3.7%
Gly (G)   7	  6.5%
His (H)   3	  2.8%
Ile (I)   6	  5.6%
Leu (L)  10	  9.3%
Lys (K)   8	  7.4%
Met (M)   4	  3.7%
Phe (F)   6	  5.6%
Pro (P)   4	  3.7%
Ser (S)   3	  2.8%
Thr (T)   9	  8.3%
Trp (W)   0	  0.0%
Tyr (Y)   5	  4.6%
Val (V)  15	 13.9%

Asx (B)   0	  0.0%
Glx (Z)   0	  0.0%
Xaa (X)   0	  0.0%

Total number of negatively charged residues (Asp + Glu): 13
Total number of positively charged residues (Arg + Lys): 9

Atomic composition:

Carbon      C	       554
Hydrogen    H	       866
Nitrogen    N	       136
Oxygen      O	       163
Sulfur      S	         5

Formula: C554H866N136O163S5
Total number of atoms: 1724

Extinction coefficients:

Conditions: 6.0 M guanidium hydrochloride
            0.02 M phosphate buffer
            pH 6.5

Extinction coefficients are in units of  M-1 cm-1 .

The first table lists values computed assuming ALL Cys 
residues appear as half cystines, whereas the second table 
assumes that NONE do. 

                      276     278     279     280     282
                       nm      nm      nm      nm      nm
Ext. coefficient     7250    7000    6725    6400    6000
Abs 0.1% (=1 g/l)   0.594   0.574   0.551   0.525   0.492



                      276     278     279     280     282
                       nm      nm      nm      nm      nm
Ext. coefficient     7250    7000    6725    6400    6000
Abs 0.1% (=1 g/l)   0.594   0.574   0.551   0.525   0.492


Estimated half-life:

The N-terminal of the sequence considered is M (Met).

The estimated half-life is: 30 hours (mammalian reticulocytes, in vitro).
                            >20 hours (yeast, in vivo).
                            >10 hours (Escherichia coli, in vivo).


Instability index:

The instability index (II) is computed to be 5.40
This classifies the protein as stable.



Aliphatic index: 99.91

Grand average of hydropathicity (GRAVY): 0.044

Back to Top


Predicted properties of MP122

ModelPercentage of MP Gene
Coiled Coil (CCP)0
Disordered (SEG)0
Transmembrane (PHDhtm)0
Transmembrane (TMHMM)0
Homologous to known structure (PSIBLAST)98

Back to Top


MP122 Prediction Details

Sequence: Amino acid sequence.
CCP (C or -): coiled coil prediction from the ccp program (NCBI toolkit)
SEG (D or -): low complexity regions (possibly disordered) from
SEG
PHDhtm (H or -): Transmembrane prediction from PHDhtm
TMHMM (H or -): Transmembrane prediction from TMHMM
PSIBLAST (3 or -): Regions potentially homologous to a protein of known 3D structure, according to PSIBLAST
Pred2ary (H, E, or -): Secondary structure prediction from Pred2ary

                 10        20        30        40        50        60        70        80
                  |         |         |         |         |         |         |         |
Sequence MKKLLVIVYPDMNDVEYTNTMVVFGFVKELQTVIYHPNLSTVKGSNGVTLVNQITSKVNLEEFDGVFIPGGMGATKVLDH
CCP      --------------------------------------------------------------------------------
SEG      --------------------------------------------------------------------------------
PHDhtm   --------------------------------------------------------------------------------
TMHMM    --------------------------------------------------------------------------------
PSIBLAST -3333333333333333333333333333333333333333333333333333333333333333333333333333333
Pred2ary --EEEEEE-------HHHHHHHHHHH----EEEEE-----------------------------EEEE------------

                 90       100
                  |         |
Sequence DQQLLDTIRYFKDHDKYVFAICDTPNVL
CCP      ----------------------------
SEG      ----------------------------
PHDhtm   ----------------------------
TMHMM    ----------------------------
PSIBLAST 3333333333333333333333333333
Pred2ary -HHHHHHHHHHHH----EEEEE------

Back to Top