|
|
Available sections:
| Target | log10(PSIBLAST E) | % identical | % coverage (of MP gene) | Latest Status |
|---|---|---|---|---|
| 1076B | -10.70 | 21.15 | 48.15 | Solubility tested (S) |
| 1139B | -23.40 | 36.09 | 100.00 | Suggested work stop (77186 77186) |
| 1142B | -17.05 | 18.10 | 100.00 | Work stopped (Homology to 1636T) |
| 1143B | -8.70 | 23.76 | 100.00 | Override suggest work stop (phasing diffraction data) |
| 1155B | -22.40 | 31.36 | 100.00 | HSQC |
| 1178B | -40.22 | 61.35 | 100.00 | Solubility tested (S) |
| 1179B | -38.40 | 62.32 | 98.57 | Purified |
| 1181B | -38.40 | 63.77 | 98.57 | Purified |
| 1184B | -16.70 | 20.61 | 100.00 | Suggested work stop (77186 77186) |
| 1192B | -41.00 | 63.51 | 100.00 | Purified |
| 1246B | -17.52 | 27.13 | 72.07 | Suggested work stop (21701 21701 77186 77186) |
| 1247B | -27.70 | 24.73 | 79.82 | Override suggest work stop (a false positive) |
| 1252B | -9.22 | 9.32 | 45.91 | Work on hold |
| 1357B | -25.00 | 40.48 | 100.00 | NMR characterization |
| 1653T | -22.70 | 55.00 | 99.01 | Suggested work stop (77186 77186 77186 78218 78218) |
| 1655T | -21.52 | 54.55 | 100.00 | Work stopped (uncertainty in predicting domain boundaries) |
| 1656T | -20.15 | 22.43 | 84.92 | Work stopped (uncertainty in predicting domain boundaries) |
| 1657T | -23.40 | 23.26 | 96.27 | Suggested work stop (77186 77186) |
| 1658T | -25.70 | 53.72 | 100.00 | Work stopped (uncertainty in predicting domain boundaries) |
| 1659T | -10.40 | 24.60 | 100.00 | Override suggest work stop (No sequence homology to the known crystal structures ) |
| 1663T | -18.40 | 33.64 | 99.07 | Suggested work stop (77186 77186 77186 78218 78218) |
| 1681T | -10.52 | 27.37 | 95.00 | Work stopped (uncertainty in predicting domain boundaries) |
| 1687T | -29.22 | 64.80 | 89.93 | Override suggest work stop (false positive) |
| 1691T | -10.70 | 35.35 | 99.00 | Work stopped (uncertainty in predicting domain boundaries) |
| 1696T | -8.70 | 32.00 | 98.68 | Work stopped (uncertainty in predicting domain boundaries) |
| 1728T | -8.22 | 58.23 | 98.75 | Work stopped (uncertainty in predicting domain boundaries) |
| 1745T | -10.70 | 18.82 | 97.70 | Work stopped (uncertainty in predicting domain boundaries) |
ATGAAAGAGAAAATTCCGTTTTATAACGAAAAGGAATTTAACGAGATGATGAAAAAGACCAAAAAGGGCACTTTTTCGGG CTGATACATCATTAATCCAGAAAACAAAAGTGTGGAATTCTCTGGCAATTTCAATAGACAATTTAAACTTAACAAACCGG TTATACCAGTGAACACGGAATACGTAACGCGCAAAGAGTTTAACGAGTACAAAGACTCAAACGACCAACGACTTACAAAG ATTGAAAATAAGGTTGATAAGCTGGAAGTTAAGGTCGATAAATTAGAAGAGAAAGTCGATAAGCTAGAAGCTAAAGTGGA CAAATTAGAAGAAAAAGTCGACAAACTTGAAGCTAAAGTGGACAAATTAGAAGAAAAAGTCGACAAACTTGAAGCTAAAG TGGACAGTGGCTTTGAAATGTTAGCTAAAATCCTTGCTGCTATTAACAAACGCCTTGATTCTATTGAAGGTCGCTTAGAC AAAATTGAACCACCCAAATAG
(167 codons) fields: [triplet] [frequency: per thousand] ([number]) UUU35.9( 6) UCU12.0( 2) UAU6.0( 1) UGU0.0( 0) UUC12.0( 2) UCC0.0( 0) UAC18.0( 3) UGC0.0( 0) UUA29.9( 5) UCA6.0( 1) UAA0.0( 0) UGA6.0( 1) UUG0.0( 0) UCG6.0( 1) UAG6.0( 1) UGG0.0( 0) CUU35.9( 6) CCU0.0( 0) CAU0.0( 0) CGU0.0( 0) CUC0.0( 0) CCC6.0( 1) CAC0.0( 0) CGC18.0( 3) CUA6.0( 1) CCA18.0( 3) CAA12.0( 2) CGA6.0( 1) CUG6.0( 1) CCG12.0( 2) CAG0.0( 0) CGG0.0( 0) AUU35.9( 6) ACU6.0( 1) AAU24.0( 4) AGU12.0( 2) AUC12.0( 2) ACC6.0( 1) AAC47.9( 8) AGC0.0( 0) AUA6.0( 1) ACA6.0( 1) AAA143.7( 24) AGA6.0( 1) AUG24.0( 4) ACG12.0( 2) AAG47.9( 8) AGG0.0( 0) GUU18.0( 3) GCU35.9( 6) GAU24.0( 4) GGU6.0( 1) GUC24.0( 4) GCC0.0( 0) GAC47.9( 8) GGC24.0( 4) GUA6.0( 1) GCA0.0( 0) GAA107.8( 18) GGA0.0( 0) GUG29.9( 5) GCG0.0( 0) GAG29.9( 5) GGG0.0( 0)
Note: This was generated using the standard codon usage table; UGA codons in MP/MP genes will show up as terminators ("*")
atgaaagagaaaattccgttttataacgaaaaggaatttaacgagatgatgaaaaagacc M K E K I P F Y N E K E F N E M M K K T aaaaagggcactttttcgggctgatacatcattaatccagaaaacaaaagtgtggaattc K K G T F S G * Y I I N P E N K S V E F tctggcaatttcaatagacaatttaaacttaacaaaccggttataccagtgaacacggaa S G N F N R Q F K L N K P V I P V N T E tacgtaacgcgcaaagagtttaacgagtacaaagactcaaacgaccaacgacttacaaag Y V T R K E F N E Y K D S N D Q R L T K attgaaaataaggttgataagctggaagttaaggtcgataaattagaagagaaagtcgat I E N K V D K L E V K V D K L E E K V D aagctagaagctaaagtggacaaattagaagaaaaagtcgacaaacttgaagctaaagtg K L E A K V D K L E E K V D K L E A K V gacaaattagaagaaaaagtcgacaaacttgaagctaaagtggacagtggctttgaaatg D K L E E K V D K L E A K V D S G F E M ttagctaaaatccttgctgctattaacaaacgccttgattctattgaaggtcgcttagac L A K I L A A I N K R L D S I E G R L D aaaattgaaccacccaaatag K I E P P K *
MKEKIPFYNEKEFNEMMKKTKKGTFSGWYIINPENKSVEFSGNFNRQFKLNKPVIPVNTEYVTRKEFNEYKDSNDQRLTK IENKVDKLEVKVDKLEEKVDKLEAKVDKLEEKVDKLEAKVDKLEEKVDKLEAKVDSGFEMLAKILAAINKRLDSIEGRLD KIEPPK
This information was obtained using the Protein Parameters tool on the ExPASy Molecular Biology Server.
Number of amino acids: 166
Molecular weight: 19518.5
Theoretical pI: 8.47
Amino acid composition:
Ala (A) 6 3.6%
Arg (R) 5 3.0%
Asn (N) 12 7.2%
Asp (D) 12 7.2%
Cys (C) 0 0.0%
Gln (Q) 2 1.2%
Glu (E) 23 13.9%
Gly (G) 5 3.0%
His (H) 0 0.0%
Ile (I) 9 5.4%
Leu (L) 13 7.8%
Lys (K) 32 19.3%
Met (M) 4 2.4%
Phe (F) 8 4.8%
Pro (P) 6 3.6%
Ser (S) 6 3.6%
Thr (T) 5 3.0%
Trp (W) 1 0.6%
Tyr (Y) 4 2.4%
Val (V) 13 7.8%
Asx (B) 0 0.0%
Glx (Z) 0 0.0%
Xaa (X) 0 0.0%
Total number of negatively charged residues (Asp + Glu): 35
Total number of positively charged residues (Arg + Lys): 37
Atomic composition:
Carbon C 875
Hydrogen H 1420
Nitrogen N 228
Oxygen O 266
Sulfur S 4
Formula: C875H1420N228O266S4
Total number of atoms: 2793
Extinction coefficients:
Conditions: 6.0 M guanidium hydrochloride
0.02 M phosphate buffer
pH 6.5
Extinction coefficients are in units of M-1 cm-1 .
276 278 279 280 282
nm nm nm nm nm
Ext. coefficient 11200 11200 11040 10810 10400
Abs 0.1% (=1 g/l) 0.574 0.574 0.566 0.554 0.533
Estimated half-life:
The N-terminal of the sequence considered is M (Met).
The estimated half-life is: 30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Instability index:
The instability index (II) is computed to be 20.99
This classifies the protein as stable.
Aliphatic index: 78.01
Grand average of hydropathicity (GRAVY): -0.961| Model | Percentage of MP Gene |
|---|---|
| Coiled Coil (CCP) | 54 |
| Disordered (SEG) | 16 |
| Transmembrane (PHDhtm) | 0 |
| Transmembrane (TMHMM) | 0 |
| Homologous to known structure (PSIBLAST) | 0 |
Sequence: Amino acid sequence.
CCP (C or -): coiled coil prediction from the ccp program (NCBI toolkit)
SEG (D or -): low complexity regions (possibly disordered) from SEG
PHDhtm (H or -): Transmembrane prediction from PHDhtm
TMHMM (H or -): Transmembrane prediction from TMHMM
PSIBLAST (3 or -): Regions potentially homologous to a protein of known 3D structure, according to PSIBLAST
Pred2ary (H, E, or -): Secondary structure prediction from Pred2ary
10 20 30 40 50 60 70 80
| | | | | | | |
Sequence MKEKIPFYNEKEFNEMMKKTKKGTFSGWYIINPENKSVEFSGNFNRQFKLNKPVIPVNTEYVTRKEFNEYKDSNDQRLTK
CCP ----------------------------------------------------------------------CCCCCCCCCC
SEG --------------------------------------------------------------------------------
PHDhtm --------------------------------------------------------------------------------
TMHMM --------------------------------------------------------------------------------
PSIBLAST --------------------------------------------------------------------------------
Pred2ary ---------HHHHHHHHHH--------EEEE-------------------------------HHHHHHHH---HHHHHHH
90 100 110 120 130 140 150 160
| | | | | | | |
Sequence IENKVDKLEVKVDKLEEKVDKLEAKVDKLEEKVDKLEAKVDKLEEKVDKLEAKVDSGFEMLAKILAAINKRLDSIEGRLD
CCP CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-
SEG ---DDDDDDDDDDDDDDDDDDDDDDDDDD---------------------------------------------------
PHDhtm --------------------------------------------------------------------------------
TMHMM --------------------------------------------------------------------------------
PSIBLAST --------------------------------------------------------------------------------
Pred2ary HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-
Sequence KIEPPK
CCP ------
SEG ------
PHDhtm ------
TMHMM ------
PSIBLAST ------
Pred2ary ------