Berkeley Structural Genomics Center

Info for MP016

This gene is gi number 1673663 from Mycoplasma pneumonia.

Available sections:


Potential Target Homologues of MP016

Targetlog10(PSIBLAST E)% identical% coverage (of MP gene)Latest Status
1076B-10.7021.1548.15Solubility tested (S)
1139B-23.4036.09100.00Suggested work stop (77186 77186)
1142B-17.0518.10100.00Work stopped (Homology to 1636T)
1143B-8.7023.76100.00Override suggest work stop (phasing diffraction data)
1155B-22.4031.36100.00HSQC
1178B-40.2261.35100.00Solubility tested (S)
1179B-38.4062.3298.57Purified
1181B-38.4063.7798.57Purified
1184B-16.7020.61100.00Suggested work stop (77186 77186)
1192B-41.0063.51100.00Purified
1246B-17.5227.1372.07Suggested work stop (21701 21701 77186 77186)
1247B-27.7024.7379.82Override suggest work stop (a false positive)
1252B-9.229.3245.91Work on hold
1357B-25.0040.48100.00NMR characterization
1653T-22.7055.0099.01Suggested work stop (77186 77186 77186 78218 78218)
1655T-21.5254.55100.00Work stopped (uncertainty in predicting domain boundaries)
1656T-20.1522.4384.92Work stopped (uncertainty in predicting domain boundaries)
1657T-23.4023.2696.27Suggested work stop (77186 77186)
1658T-25.7053.72100.00Work stopped (uncertainty in predicting domain boundaries)
1659T-10.4024.60100.00Override suggest work stop (No sequence homology to the known crystal structures )
1663T-18.4033.6499.07Suggested work stop (77186 77186 77186 78218 78218)
1681T-10.5227.3795.00Work stopped (uncertainty in predicting domain boundaries)
1687T-29.2264.8089.93Override suggest work stop (false positive)
1691T-10.7035.3599.00Work stopped (uncertainty in predicting domain boundaries)
1696T-8.7032.0098.68Work stopped (uncertainty in predicting domain boundaries)
1728T-8.2258.2398.75Work stopped (uncertainty in predicting domain boundaries)
1745T-10.7018.8297.70Work stopped (uncertainty in predicting domain boundaries)

Back to Top


MP016 DNA sequence

ATGAAAGAGAAAATTCCGTTTTATAACGAAAAGGAATTTAACGAGATGATGAAAAAGACCAAAAAGGGCACTTTTTCGGG
CTGATACATCATTAATCCAGAAAACAAAAGTGTGGAATTCTCTGGCAATTTCAATAGACAATTTAAACTTAACAAACCGG
TTATACCAGTGAACACGGAATACGTAACGCGCAAAGAGTTTAACGAGTACAAAGACTCAAACGACCAACGACTTACAAAG
ATTGAAAATAAGGTTGATAAGCTGGAAGTTAAGGTCGATAAATTAGAAGAGAAAGTCGATAAGCTAGAAGCTAAAGTGGA
CAAATTAGAAGAAAAAGTCGACAAACTTGAAGCTAAAGTGGACAAATTAGAAGAAAAAGTCGACAAACTTGAAGCTAAAG
TGGACAGTGGCTTTGAAATGTTAGCTAAAATCCTTGCTGCTATTAACAAACGCCTTGATTCTATTGAAGGTCGCTTAGAC
AAAATTGAACCACCCAAATAG

Back to Top


MP016 Codon Usage

(167 codons)
fields: [triplet] [frequency: per thousand] ([number])

UUU35.9(   6)  UCU12.0(   2)  UAU6.0(   1)  UGU0.0(   0)  
UUC12.0(   2)  UCC0.0(   0)  UAC18.0(   3)  UGC0.0(   0)  
UUA29.9(   5)  UCA6.0(   1)  UAA0.0(   0)  UGA6.0(   1)  
UUG0.0(   0)  UCG6.0(   1)  UAG6.0(   1)  UGG0.0(   0)  

CUU35.9(   6)  CCU0.0(   0)  CAU0.0(   0)  CGU0.0(   0)  
CUC0.0(   0)  CCC6.0(   1)  CAC0.0(   0)  CGC18.0(   3)  
CUA6.0(   1)  CCA18.0(   3)  CAA12.0(   2)  CGA6.0(   1)  
CUG6.0(   1)  CCG12.0(   2)  CAG0.0(   0)  CGG0.0(   0)  

AUU35.9(   6)  ACU6.0(   1)  AAU24.0(   4)  AGU12.0(   2)  
AUC12.0(   2)  ACC6.0(   1)  AAC47.9(   8)  AGC0.0(   0)  
AUA6.0(   1)  ACA6.0(   1)  AAA143.7(  24)  AGA6.0(   1)  
AUG24.0(   4)  ACG12.0(   2)  AAG47.9(   8)  AGG0.0(   0)  

GUU18.0(   3)  GCU35.9(   6)  GAU24.0(   4)  GGU6.0(   1)  
GUC24.0(   4)  GCC0.0(   0)  GAC47.9(   8)  GGC24.0(   4)  
GUA6.0(   1)  GCA0.0(   0)  GAA107.8(  18)  GGA0.0(   0)  
GUG29.9(   5)  GCG0.0(   0)  GAG29.9(   5)  GGG0.0(   0)  

Back to Top


MP016 Translation

Note: This was generated using the standard codon usage table; UGA codons in MP/MP genes will show up as terminators ("*")

atgaaagagaaaattccgttttataacgaaaaggaatttaacgagatgatgaaaaagacc
 M  K  E  K  I  P  F  Y  N  E  K  E  F  N  E  M  M  K  K  T 
aaaaagggcactttttcgggctgatacatcattaatccagaaaacaaaagtgtggaattc
 K  K  G  T  F  S  G  *  Y  I  I  N  P  E  N  K  S  V  E  F 
tctggcaatttcaatagacaatttaaacttaacaaaccggttataccagtgaacacggaa
 S  G  N  F  N  R  Q  F  K  L  N  K  P  V  I  P  V  N  T  E 
tacgtaacgcgcaaagagtttaacgagtacaaagactcaaacgaccaacgacttacaaag
 Y  V  T  R  K  E  F  N  E  Y  K  D  S  N  D  Q  R  L  T  K 
attgaaaataaggttgataagctggaagttaaggtcgataaattagaagagaaagtcgat
 I  E  N  K  V  D  K  L  E  V  K  V  D  K  L  E  E  K  V  D 
aagctagaagctaaagtggacaaattagaagaaaaagtcgacaaacttgaagctaaagtg
 K  L  E  A  K  V  D  K  L  E  E  K  V  D  K  L  E  A  K  V 
gacaaattagaagaaaaagtcgacaaacttgaagctaaagtggacagtggctttgaaatg
 D  K  L  E  E  K  V  D  K  L  E  A  K  V  D  S  G  F  E  M 
ttagctaaaatccttgctgctattaacaaacgccttgattctattgaaggtcgcttagac
 L  A  K  I  L  A  A  I  N  K  R  L  D  S  I  E  G  R  L  D 
aaaattgaaccacccaaatag
 K  I  E  P  P  K  * 

Back to Top


MP016 AA Sequence

MKEKIPFYNEKEFNEMMKKTKKGTFSGWYIINPENKSVEFSGNFNRQFKLNKPVIPVNTEYVTRKEFNEYKDSNDQRLTK
IENKVDKLEVKVDKLEEKVDKLEAKVDKLEEKVDKLEAKVDKLEEKVDKLEAKVDSGFEMLAKILAAINKRLDSIEGRLD
KIEPPK

Back to Top


MP016 Protein Parameters

This information was obtained using the Protein Parameters tool on the ExPASy Molecular Biology Server.

Number of amino acids: 166

Molecular weight: 19518.5

Theoretical pI: 8.47

Amino acid composition:

Ala (A)   6	  3.6%
Arg (R)   5	  3.0%
Asn (N)  12	  7.2%
Asp (D)  12	  7.2%
Cys (C)   0	  0.0%
Gln (Q)   2	  1.2%
Glu (E)  23	 13.9%
Gly (G)   5	  3.0%
His (H)   0	  0.0%
Ile (I)   9	  5.4%
Leu (L)  13	  7.8%
Lys (K)  32	 19.3%
Met (M)   4	  2.4%
Phe (F)   8	  4.8%
Pro (P)   6	  3.6%
Ser (S)   6	  3.6%
Thr (T)   5	  3.0%
Trp (W)   1	  0.6%
Tyr (Y)   4	  2.4%
Val (V)  13	  7.8%

Asx (B)   0	  0.0%
Glx (Z)   0	  0.0%
Xaa (X)   0	  0.0%

Total number of negatively charged residues (Asp + Glu): 35
Total number of positively charged residues (Arg + Lys): 37

Atomic composition:

Carbon      C	       875
Hydrogen    H	      1420
Nitrogen    N	       228
Oxygen      O	       266
Sulfur      S	         4

Formula: C875H1420N228O266S4
Total number of atoms: 2793

Extinction coefficients:

Conditions: 6.0 M guanidium hydrochloride
            0.02 M phosphate buffer
            pH 6.5

Extinction coefficients are in units of  M-1 cm-1 .

                      276     278     279     280     282
                       nm      nm      nm      nm      nm
Ext. coefficient    11200   11200   11040   10810   10400
Abs 0.1% (=1 g/l)   0.574   0.574   0.566   0.554   0.533


Estimated half-life:

The N-terminal of the sequence considered is M (Met).

The estimated half-life is: 30 hours (mammalian reticulocytes, in vitro).
                            >20 hours (yeast, in vivo).
                            >10 hours (Escherichia coli, in vivo).


Instability index:

The instability index (II) is computed to be 20.99
This classifies the protein as stable.



Aliphatic index: 78.01

Grand average of hydropathicity (GRAVY): -0.961

Back to Top


Predicted properties of MP016

ModelPercentage of MP Gene
Coiled Coil (CCP)54
Disordered (SEG)16
Transmembrane (PHDhtm)0
Transmembrane (TMHMM)0
Homologous to known structure (PSIBLAST)0

Back to Top


MP016 Prediction Details

Sequence: Amino acid sequence.
CCP (C or -): coiled coil prediction from the ccp program (NCBI toolkit)
SEG (D or -): low complexity regions (possibly disordered) from
SEG
PHDhtm (H or -): Transmembrane prediction from PHDhtm
TMHMM (H or -): Transmembrane prediction from TMHMM
PSIBLAST (3 or -): Regions potentially homologous to a protein of known 3D structure, according to PSIBLAST
Pred2ary (H, E, or -): Secondary structure prediction from Pred2ary

                 10        20        30        40        50        60        70        80
                  |         |         |         |         |         |         |         |
Sequence MKEKIPFYNEKEFNEMMKKTKKGTFSGWYIINPENKSVEFSGNFNRQFKLNKPVIPVNTEYVTRKEFNEYKDSNDQRLTK
CCP      ----------------------------------------------------------------------CCCCCCCCCC
SEG      --------------------------------------------------------------------------------
PHDhtm   --------------------------------------------------------------------------------
TMHMM    --------------------------------------------------------------------------------
PSIBLAST --------------------------------------------------------------------------------
Pred2ary ---------HHHHHHHHHH--------EEEE-------------------------------HHHHHHHH---HHHHHHH

                 90       100       110       120       130       140       150       160
                  |         |         |         |         |         |         |         |
Sequence IENKVDKLEVKVDKLEEKVDKLEAKVDKLEEKVDKLEAKVDKLEEKVDKLEAKVDSGFEMLAKILAAINKRLDSIEGRLD
CCP      CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-
SEG      ---DDDDDDDDDDDDDDDDDDDDDDDDDD---------------------------------------------------
PHDhtm   --------------------------------------------------------------------------------
TMHMM    --------------------------------------------------------------------------------
PSIBLAST --------------------------------------------------------------------------------
Pred2ary HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-

         
         
Sequence KIEPPK
CCP      ------
SEG      ------
PHDhtm   ------
TMHMM    ------
PSIBLAST ------
Pred2ary ------

Back to Top