Berkeley Structural Genomics Center

Info for MP037

This gene is gi number 1673686 from Mycoplasma pneumonia.

Available sections:


Potential Target Homologues of MP037

No target homologues identified for this gene.

Back to Top


MP037 DNA sequence

ATGAGAATTAAAGGTGGAAAACAAACCCGCGTACGTCGCAAGAAGTGGTTAAAGCAAGCTAGTGGTAGCTTTGGTACCCG
ACATGCCTCTTATAAGGTGGCAAAGCAAACGGTGATCCAAGCCGCTAAGTATGCTTACCGCGATCGTCGTAACAAAAAGC
GCGATTTCCGTTCGTTGTGGATCTTGCGCTTAAACGCCGCTTTGCGCGAACAGGGCATGACCTATTCGGTCTTTATCAAT
CTATTGAAGAAGCACAACATTGAGATTAACCGCAAAGTGTTGTCGGAACTAGCCATTAAAGAACCAAGTAAATTTAACCT
AATTGTGCAAAAGGTTAAAAGTGAACAACCGAAAGCCGCTAAGCCAGCTGCTTTAGGAAACTAG

Back to Top


MP037 Codon Usage

(128 codons)
fields: [triplet] [frequency: per thousand] ([number])

UUU23.4(   3)  UCU7.8(   1)  UAU23.4(   3)  UGU0.0(   0)  
UUC7.8(   1)  UCC0.0(   0)  UAC7.8(   1)  UGC0.0(   0)  
UUA23.4(   3)  UCA0.0(   0)  UAA0.0(   0)  UGA0.0(   0)  
UUG39.1(   5)  UCG23.4(   3)  UAG7.8(   1)  UGG15.6(   2)  

CUU0.0(   0)  CCU0.0(   0)  CAU7.8(   1)  CGU31.2(   4)  
CUC0.0(   0)  CCC0.0(   0)  CAC7.8(   1)  CGC54.7(   7)  
CUA23.4(   3)  CCA15.6(   2)  CAA46.9(   6)  CGA7.8(   1)  
CUG0.0(   0)  CCG7.8(   1)  CAG7.8(   1)  CGG0.0(   0)  

AUU39.1(   5)  ACU0.0(   0)  AAU7.8(   1)  AGU23.4(   3)  
AUC23.4(   3)  ACC23.4(   3)  AAC46.9(   6)  AGC7.8(   1)  
AUA0.0(   0)  ACA0.0(   0)  AAA62.5(   8)  AGA7.8(   1)  
AUG15.6(   2)  ACG7.8(   1)  AAG85.9(  11)  AGG0.0(   0)  

GUU7.8(   1)  GCU54.7(   7)  GAU15.6(   2)  GGU23.4(   3)  
GUC7.8(   1)  GCC39.1(   5)  GAC0.0(   0)  GGC7.8(   1)  
GUA7.8(   1)  GCA7.8(   1)  GAA31.2(   4)  GGA15.6(   2)  
GUG31.2(   4)  GCG0.0(   0)  GAG7.8(   1)  GGG0.0(   0)  

Back to Top


MP037 Translation

Note: This was generated using the standard codon usage table; UGA codons in MP/MP genes will show up as terminators ("*")

atgagaattaaaggtggaaaacaaacccgcgtacgtcgcaagaagtggttaaagcaagct
 M  R  I  K  G  G  K  Q  T  R  V  R  R  K  K  W  L  K  Q  A 
agtggtagctttggtacccgacatgcctcttataaggtggcaaagcaaacggtgatccaa
 S  G  S  F  G  T  R  H  A  S  Y  K  V  A  K  Q  T  V  I  Q 
gccgctaagtatgcttaccgcgatcgtcgtaacaaaaagcgcgatttccgttcgttgtgg
 A  A  K  Y  A  Y  R  D  R  R  N  K  K  R  D  F  R  S  L  W 
atcttgcgcttaaacgccgctttgcgcgaacagggcatgacctattcggtctttatcaat
 I  L  R  L  N  A  A  L  R  E  Q  G  M  T  Y  S  V  F  I  N 
ctattgaagaagcacaacattgagattaaccgcaaagtgttgtcggaactagccattaaa
 L  L  K  K  H  N  I  E  I  N  R  K  V  L  S  E  L  A  I  K 
gaaccaagtaaatttaacctaattgtgcaaaaggttaaaagtgaacaaccgaaagccgct
 E  P  S  K  F  N  L  I  V  Q  K  V  K  S  E  Q  P  K  A  A 
aagccagctgctttaggaaactag
 K  P  A  A  L  G  N  * 

Back to Top


MP037 AA Sequence

MRIKGGKQTRVRRKKWLKQASGSFGTRHASYKVAKQTVIQAAKYAYRDRRNKKRDFRSLWILRLNAALREQGMTYSVFIN
LLKKHNIEINRKVLSELAIKEPSKFNLIVQKVKSEQPKAAKPAALGN

Back to Top


MP037 Protein Parameters

This information was obtained using the Protein Parameters tool on the ExPASy Molecular Biology Server.

Number of amino acids: 127

Molecular weight: 14708.3

Theoretical pI: 11.29

Amino acid composition:

Ala (A)  13	 10.2%
Arg (R)  13	 10.2%
Asn (N)   7	  5.5%
Asp (D)   2	  1.6%
Cys (C)   0	  0.0%
Gln (Q)   7	  5.5%
Glu (E)   5	  3.9%
Gly (G)   6	  4.7%
His (H)   2	  1.6%
Ile (I)   8	  6.3%
Leu (L)  11	  8.7%
Lys (K)  19	 15.0%
Met (M)   2	  1.6%
Phe (F)   4	  3.1%
Pro (P)   3	  2.4%
Ser (S)   8	  6.3%
Thr (T)   4	  3.1%
Trp (W)   2	  1.6%
Tyr (Y)   4	  3.1%
Val (V)   7	  5.5%

Asx (B)   0	  0.0%
Glx (Z)   0	  0.0%
Xaa (X)   0	  0.0%

Total number of negatively charged residues (Asp + Glu): 7
Total number of positively charged residues (Arg + Lys): 32

Atomic composition:

Carbon      C	       659
Hydrogen    H	      1097
Nitrogen    N	       205
Oxygen      O	       172
Sulfur      S	         2

Formula: C659H1097N205O172S2
Total number of atoms: 2135

Extinction coefficients:

Conditions: 6.0 M guanidium hydrochloride
            0.02 M phosphate buffer
            pH 6.5

Extinction coefficients are in units of  M-1 cm-1 .

                      276     278     279     280     282
                       nm      nm      nm      nm      nm
Ext. coefficient    16600   16800   16700   16500   16000
Abs 0.1% (=1 g/l)   1.129   1.142   1.135   1.122   1.088


Estimated half-life:

The N-terminal of the sequence considered is M (Met).

The estimated half-life is: 30 hours (mammalian reticulocytes, in vitro).
                            >20 hours (yeast, in vivo).
                            >10 hours (Escherichia coli, in vivo).


Instability index:

The instability index (II) is computed to be 55.39
This classifies the protein as unstable.



Aliphatic index: 84.57

Grand average of hydropathicity (GRAVY): -0.711

Back to Top


Predicted properties of MP037

ModelPercentage of MP Gene
Coiled Coil (CCP)0
Disordered (SEG)0
Transmembrane (PHDhtm)0
Transmembrane (TMHMM)0
Homologous to known structure (PSIBLAST)0

Back to Top


MP037 Prediction Details

Sequence: Amino acid sequence.
CCP (C or -): coiled coil prediction from the ccp program (NCBI toolkit)
SEG (D or -): low complexity regions (possibly disordered) from
SEG
PHDhtm (H or -): Transmembrane prediction from PHDhtm
TMHMM (H or -): Transmembrane prediction from TMHMM
PSIBLAST (3 or -): Regions potentially homologous to a protein of known 3D structure, according to PSIBLAST
Pred2ary (H, E, or -): Secondary structure prediction from Pred2ary

                 10        20        30        40        50        60        70        80
                  |         |         |         |         |         |         |         |
Sequence MRIKGGKQTRVRRKKWLKQASGSFGTRHASYKVAKQTVIQAAKYAYRDRRNKKRDFRSLWILRLNAALREQGMTYSVFIN
CCP      --------------------------------------------------------------------------------
SEG      --------------------------------------------------------------------------------
PHDhtm   --------------------------------------------------------------------------------
TMHMM    --------------------------------------------------------------------------------
PSIBLAST --------------------------------------------------------------------------------
Pred2ary ------HHHHHHHHHHHHHHH-----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHH

                 90       100       110       120
                  |         |         |         |
Sequence LLKKHNIEINRKVLSELAIKEPSKFNLIVQKVKSEQPKAAKPAALGN
CCP      -----------------------------------------------
SEG      -----------------------------------------------
PHDhtm   -----------------------------------------------
TMHMM    -----------------------------------------------
PSIBLAST -----------------------------------------------
Pred2ary HHHHH---HHHHHHHHHH---HHHHHHHHHHHHHHHHHH--HHH---

Back to Top