Berkeley Structural Genomics Center

Info for MP045

This gene is gi number 1673694 from Mycoplasma pneumonia.

Available sections:


Potential Target Homologues of MP045

Targetlog10(PSIBLAST E)% identical% coverage (of MP gene)Latest Status
1389B-85.40100.00100.00Purified

Back to Top


MP045 DNA sequence

ATGAAATTTAAGCTTAATTTTCACGAAAAAATCAACCAAAAAGATTGCTGACAATCTCTAATTGATCACAAGGAACGTTC
CTACTCATTAGACTTCGTTAATAATACGGAAAAGGAACTACCACTTATCTATGGATACGAAGTAAAAGACTTTGAAAATC
ACGGGGTTAAAATTGGTTATACAACATGTAAACCGTCTGATAAAATTCAATCAGCGATAGAAGAACGTATCCTTTCACAA
GAAAAAGAATTTCGCTTTTTAGATGAAAATATAGAAAAGATAGAGGAAGTTAAAGTTATCTTTTGAGCTATTGCCATCAA
TGAAAAGGATGAATCATTCAAGGATTATTCACTCCATTCATTTATTAAGGAAAAAAACTTATTAAAAGAATCGCAAGCTG
GCGGTGAATGGTTCATAGTTGATGAAAATAAGGATAAGTTTGAATATCTTAGCCAAATTTTTAGACAGTTTCGCGCACCT
TCTCTTTTTAAAAAATAA

Back to Top


MP045 Codon Usage

(166 codons)
fields: [triplet] [frequency: per thousand] ([number])

UUU66.3(  11)  UCU18.1(   3)  UAU24.1(   4)  UGU6.0(   1)  
UUC18.1(   3)  UCC6.0(   1)  UAC12.0(   2)  UGC6.0(   1)  
UUA24.1(   4)  UCA36.1(   6)  UAA6.0(   1)  UGA12.0(   2)  
UUG0.0(   0)  UCG6.0(   1)  UAG0.0(   0)  UGG6.0(   1)  

CUU30.1(   5)  CCU6.0(   1)  CAU6.0(   1)  CGU12.0(   2)  
CUC6.0(   1)  CCC0.0(   0)  CAC18.1(   3)  CGC12.0(   2)  
CUA12.0(   2)  CCA6.0(   1)  CAA36.1(   6)  CGA0.0(   0)  
CUG0.0(   0)  CCG6.0(   1)  CAG6.0(   1)  CGG0.0(   0)  

AUU36.1(   6)  ACU0.0(   0)  AAU42.2(   7)  AGU0.0(   0)  
AUC30.1(   5)  ACC0.0(   0)  AAC12.0(   2)  AGC6.0(   1)  
AUA24.1(   4)  ACA12.0(   2)  AAA78.3(  13)  AGA6.0(   1)  
AUG6.0(   1)  ACG6.0(   1)  AAG54.2(   9)  AGG0.0(   0)  

GUU30.1(   5)  GCU12.0(   2)  GAU48.2(   8)  GGU12.0(   2)  
GUC0.0(   0)  GCC6.0(   1)  GAC12.0(   2)  GGC6.0(   1)  
GUA6.0(   1)  GCA6.0(   1)  GAA120.5(  20)  GGA6.0(   1)  
GUG0.0(   0)  GCG6.0(   1)  GAG6.0(   1)  GGG6.0(   1)  

Back to Top


MP045 Translation

Note: This was generated using the standard codon usage table; UGA codons in MP/MP genes will show up as terminators ("*")

atgaaatttaagcttaattttcacgaaaaaatcaaccaaaaagattgctgacaatctcta
 M  K  F  K  L  N  F  H  E  K  I  N  Q  K  D  C  *  Q  S  L 
attgatcacaaggaacgttcctactcattagacttcgttaataatacggaaaaggaacta
 I  D  H  K  E  R  S  Y  S  L  D  F  V  N  N  T  E  K  E  L 
ccacttatctatggatacgaagtaaaagactttgaaaatcacggggttaaaattggttat
 P  L  I  Y  G  Y  E  V  K  D  F  E  N  H  G  V  K  I  G  Y 
acaacatgtaaaccgtctgataaaattcaatcagcgatagaagaacgtatcctttcacaa
 T  T  C  K  P  S  D  K  I  Q  S  A  I  E  E  R  I  L  S  Q 
gaaaaagaatttcgctttttagatgaaaatatagaaaagatagaggaagttaaagttatc
 E  K  E  F  R  F  L  D  E  N  I  E  K  I  E  E  V  K  V  I 
ttttgagctattgccatcaatgaaaaggatgaatcattcaaggattattcactccattca
 F  *  A  I  A  I  N  E  K  D  E  S  F  K  D  Y  S  L  H  S 
tttattaaggaaaaaaacttattaaaagaatcgcaagctggcggtgaatggttcatagtt
 F  I  K  E  K  N  L  L  K  E  S  Q  A  G  G  E  W  F  I  V 
gatgaaaataaggataagtttgaatatcttagccaaatttttagacagtttcgcgcacct
 D  E  N  K  D  K  F  E  Y  L  S  Q  I  F  R  Q  F  R  A  P 
tctctttttaaaaaataa
 S  L  F  K  K  * 

Back to Top


MP045 AA Sequence

MKFKLNFHEKINQKDCWQSLIDHKERSYSLDFVNNTEKELPLIYGYEVKDFENHGVKIGYTTCKPSDKIQSAIEERILSQ
EKEFRFLDENIEKIEEVKVIFWAIAINEKDESFKDYSLHSFIKEKNLLKESQAGGEWFIVDENKDKFEYLSQIFRQFRAP
SLFKK

Back to Top


MP045 Protein Parameters

This information was obtained using the Protein Parameters tool on the ExPASy Molecular Biology Server.

Number of amino acids: 165

Molecular weight: 19819.5

Theoretical pI: 5.68

Amino acid composition:

Ala (A)   5	  3.0%
Arg (R)   5	  3.0%
Asn (N)   9	  5.5%
Asp (D)  10	  6.1%
Cys (C)   2	  1.2%
Gln (Q)   7	  4.2%
Glu (E)  21	 12.7%
Gly (G)   5	  3.0%
His (H)   4	  2.4%
Ile (I)  15	  9.1%
Leu (L)  12	  7.3%
Lys (K)  22	 13.3%
Met (M)   1	  0.6%
Phe (F)  14	  8.5%
Pro (P)   3	  1.8%
Ser (S)  12	  7.3%
Thr (T)   3	  1.8%
Trp (W)   3	  1.8%
Tyr (Y)   6	  3.6%
Val (V)   6	  3.6%

Asx (B)   0	  0.0%
Glx (Z)   0	  0.0%
Xaa (X)   0	  0.0%

Total number of negatively charged residues (Asp + Glu): 31
Total number of positively charged residues (Arg + Lys): 27

Atomic composition:

Carbon      C	       906
Hydrogen    H	      1383
Nitrogen    N	       229
Oxygen      O	       265
Sulfur      S	         3

Formula: C906H1383N229O265S3
Total number of atoms: 2786

Extinction coefficients:

Conditions: 6.0 M guanidium hydrochloride
            0.02 M phosphate buffer
            pH 6.5

Extinction coefficients are in units of  M-1 cm-1 .

The first table lists values computed assuming ALL Cys 
residues appear as half cystines, whereas the second table 
assumes that NONE do. 

                      276     278     279     280     282
                       nm      nm      nm      nm      nm
Ext. coefficient    25045   25327   25170   24870   24120
Abs 0.1% (=1 g/l)   1.264   1.278   1.270   1.255   1.217



                      276     278     279     280     282
                       nm      nm      nm      nm      nm
Ext. coefficient    24900   25200   25050   24750   24000
Abs 0.1% (=1 g/l)   1.256   1.271   1.264   1.249   1.211


Estimated half-life:

The N-terminal of the sequence considered is M (Met).

The estimated half-life is: 30 hours (mammalian reticulocytes, in vitro).
                            >20 hours (yeast, in vivo).
                            >10 hours (Escherichia coli, in vivo).


Instability index:

The instability index (II) is computed to be 33.80
This classifies the protein as stable.



Aliphatic index: 77.39

Grand average of hydropathicity (GRAVY): -0.735

Back to Top


Predicted properties of MP045

ModelPercentage of MP Gene
Coiled Coil (CCP)13
Disordered (SEG)6
Transmembrane (PHDhtm)0
Transmembrane (TMHMM)0
Homologous to known structure (PSIBLAST)0

Back to Top


MP045 Prediction Details

Sequence: Amino acid sequence.
CCP (C or -): coiled coil prediction from the ccp program (NCBI toolkit)
SEG (D or -): low complexity regions (possibly disordered) from
SEG
PHDhtm (H or -): Transmembrane prediction from PHDhtm
TMHMM (H or -): Transmembrane prediction from TMHMM
PSIBLAST (3 or -): Regions potentially homologous to a protein of known 3D structure, according to PSIBLAST
Pred2ary (H, E, or -): Secondary structure prediction from Pred2ary

                 10        20        30        40        50        60        70        80
                  |         |         |         |         |         |         |         |
Sequence MKFKLNFHEKINQKDCWQSLIDHKERSYSLDFVNNTEKELPLIYGYEVKDFENHGVKIGYTTCKPSDKIQSAIEERILSQ
CCP      ----------------------------------------------------------------------------CCCC
SEG      --------------------------------------------------------------------------------
PHDhtm   --------------------------------------------------------------------------------
TMHMM    --------------------------------------------------------------------------------
PSIBLAST --------------------------------------------------------------------------------
Pred2ary -EEEE---HH----HHHHHHHHH------------------EEE-----------EEEE--------HHHHHHHHHHH--

                 90       100       110       120       130       140       150       160
                  |         |         |         |         |         |         |         |
Sequence EKEFRFLDENIEKIEEVKVIFWAIAINEKDESFKDYSLHSFIKEKNLLKESQAGGEWFIVDENKDKFEYLSQIFRQFRAP
CCP      CCCCCCCCCCCCCCCCCC--------------------------------------------------------------
SEG      ----------DDDDDDDDDD------------------------------------------------------------
PHDhtm   --------------------------------------------------------------------------------
TMHMM    --------------------------------------------------------------------------------
PSIBLAST --------------------------------------------------------------------------------
Pred2ary ----HHHHHHHHHHHHHHHHHHHHH---------HHHHHHHHHHH--H--------EEEE-----HHHHHHHHHHHHH--

         
         
Sequence SLFKK
CCP      -----
SEG      -----
PHDhtm   -----
TMHMM    -----
PSIBLAST -----
Pred2ary -----

Back to Top