|
|
Available sections:
| Target | log10(PSIBLAST E) | % identical | % coverage (of MP gene) | Latest Status |
|---|---|---|---|---|
| 1389B | -85.40 | 100.00 | 100.00 | Purified |
ATGAAATTTAAGCTTAATTTTCACGAAAAAATCAACCAAAAAGATTGCTGACAATCTCTAATTGATCACAAGGAACGTTC CTACTCATTAGACTTCGTTAATAATACGGAAAAGGAACTACCACTTATCTATGGATACGAAGTAAAAGACTTTGAAAATC ACGGGGTTAAAATTGGTTATACAACATGTAAACCGTCTGATAAAATTCAATCAGCGATAGAAGAACGTATCCTTTCACAA GAAAAAGAATTTCGCTTTTTAGATGAAAATATAGAAAAGATAGAGGAAGTTAAAGTTATCTTTTGAGCTATTGCCATCAA TGAAAAGGATGAATCATTCAAGGATTATTCACTCCATTCATTTATTAAGGAAAAAAACTTATTAAAAGAATCGCAAGCTG GCGGTGAATGGTTCATAGTTGATGAAAATAAGGATAAGTTTGAATATCTTAGCCAAATTTTTAGACAGTTTCGCGCACCT TCTCTTTTTAAAAAATAA
(166 codons) fields: [triplet] [frequency: per thousand] ([number]) UUU66.3( 11) UCU18.1( 3) UAU24.1( 4) UGU6.0( 1) UUC18.1( 3) UCC6.0( 1) UAC12.0( 2) UGC6.0( 1) UUA24.1( 4) UCA36.1( 6) UAA6.0( 1) UGA12.0( 2) UUG0.0( 0) UCG6.0( 1) UAG0.0( 0) UGG6.0( 1) CUU30.1( 5) CCU6.0( 1) CAU6.0( 1) CGU12.0( 2) CUC6.0( 1) CCC0.0( 0) CAC18.1( 3) CGC12.0( 2) CUA12.0( 2) CCA6.0( 1) CAA36.1( 6) CGA0.0( 0) CUG0.0( 0) CCG6.0( 1) CAG6.0( 1) CGG0.0( 0) AUU36.1( 6) ACU0.0( 0) AAU42.2( 7) AGU0.0( 0) AUC30.1( 5) ACC0.0( 0) AAC12.0( 2) AGC6.0( 1) AUA24.1( 4) ACA12.0( 2) AAA78.3( 13) AGA6.0( 1) AUG6.0( 1) ACG6.0( 1) AAG54.2( 9) AGG0.0( 0) GUU30.1( 5) GCU12.0( 2) GAU48.2( 8) GGU12.0( 2) GUC0.0( 0) GCC6.0( 1) GAC12.0( 2) GGC6.0( 1) GUA6.0( 1) GCA6.0( 1) GAA120.5( 20) GGA6.0( 1) GUG0.0( 0) GCG6.0( 1) GAG6.0( 1) GGG6.0( 1)
Note: This was generated using the standard codon usage table; UGA codons in MP/MP genes will show up as terminators ("*")
atgaaatttaagcttaattttcacgaaaaaatcaaccaaaaagattgctgacaatctcta M K F K L N F H E K I N Q K D C * Q S L attgatcacaaggaacgttcctactcattagacttcgttaataatacggaaaaggaacta I D H K E R S Y S L D F V N N T E K E L ccacttatctatggatacgaagtaaaagactttgaaaatcacggggttaaaattggttat P L I Y G Y E V K D F E N H G V K I G Y acaacatgtaaaccgtctgataaaattcaatcagcgatagaagaacgtatcctttcacaa T T C K P S D K I Q S A I E E R I L S Q gaaaaagaatttcgctttttagatgaaaatatagaaaagatagaggaagttaaagttatc E K E F R F L D E N I E K I E E V K V I ttttgagctattgccatcaatgaaaaggatgaatcattcaaggattattcactccattca F * A I A I N E K D E S F K D Y S L H S tttattaaggaaaaaaacttattaaaagaatcgcaagctggcggtgaatggttcatagtt F I K E K N L L K E S Q A G G E W F I V gatgaaaataaggataagtttgaatatcttagccaaatttttagacagtttcgcgcacct D E N K D K F E Y L S Q I F R Q F R A P tctctttttaaaaaataa S L F K K *
MKFKLNFHEKINQKDCWQSLIDHKERSYSLDFVNNTEKELPLIYGYEVKDFENHGVKIGYTTCKPSDKIQSAIEERILSQ EKEFRFLDENIEKIEEVKVIFWAIAINEKDESFKDYSLHSFIKEKNLLKESQAGGEWFIVDENKDKFEYLSQIFRQFRAP SLFKK
This information was obtained using the Protein Parameters tool on the ExPASy Molecular Biology Server.
Number of amino acids: 165
Molecular weight: 19819.5
Theoretical pI: 5.68
Amino acid composition:
Ala (A) 5 3.0%
Arg (R) 5 3.0%
Asn (N) 9 5.5%
Asp (D) 10 6.1%
Cys (C) 2 1.2%
Gln (Q) 7 4.2%
Glu (E) 21 12.7%
Gly (G) 5 3.0%
His (H) 4 2.4%
Ile (I) 15 9.1%
Leu (L) 12 7.3%
Lys (K) 22 13.3%
Met (M) 1 0.6%
Phe (F) 14 8.5%
Pro (P) 3 1.8%
Ser (S) 12 7.3%
Thr (T) 3 1.8%
Trp (W) 3 1.8%
Tyr (Y) 6 3.6%
Val (V) 6 3.6%
Asx (B) 0 0.0%
Glx (Z) 0 0.0%
Xaa (X) 0 0.0%
Total number of negatively charged residues (Asp + Glu): 31
Total number of positively charged residues (Arg + Lys): 27
Atomic composition:
Carbon C 906
Hydrogen H 1383
Nitrogen N 229
Oxygen O 265
Sulfur S 3
Formula: C906H1383N229O265S3
Total number of atoms: 2786
Extinction coefficients:
Conditions: 6.0 M guanidium hydrochloride
0.02 M phosphate buffer
pH 6.5
Extinction coefficients are in units of M-1 cm-1 .
The first table lists values computed assuming ALL Cys
residues appear as half cystines, whereas the second table
assumes that NONE do.
276 278 279 280 282
nm nm nm nm nm
Ext. coefficient 25045 25327 25170 24870 24120
Abs 0.1% (=1 g/l) 1.264 1.278 1.270 1.255 1.217
276 278 279 280 282
nm nm nm nm nm
Ext. coefficient 24900 25200 25050 24750 24000
Abs 0.1% (=1 g/l) 1.256 1.271 1.264 1.249 1.211
Estimated half-life:
The N-terminal of the sequence considered is M (Met).
The estimated half-life is: 30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Instability index:
The instability index (II) is computed to be 33.80
This classifies the protein as stable.
Aliphatic index: 77.39
Grand average of hydropathicity (GRAVY): -0.735| Model | Percentage of MP Gene |
|---|---|
| Coiled Coil (CCP) | 13 |
| Disordered (SEG) | 6 |
| Transmembrane (PHDhtm) | 0 |
| Transmembrane (TMHMM) | 0 |
| Homologous to known structure (PSIBLAST) | 0 |
Sequence: Amino acid sequence.
CCP (C or -): coiled coil prediction from the ccp program (NCBI toolkit)
SEG (D or -): low complexity regions (possibly disordered) from SEG
PHDhtm (H or -): Transmembrane prediction from PHDhtm
TMHMM (H or -): Transmembrane prediction from TMHMM
PSIBLAST (3 or -): Regions potentially homologous to a protein of known 3D structure, according to PSIBLAST
Pred2ary (H, E, or -): Secondary structure prediction from Pred2ary
10 20 30 40 50 60 70 80
| | | | | | | |
Sequence MKFKLNFHEKINQKDCWQSLIDHKERSYSLDFVNNTEKELPLIYGYEVKDFENHGVKIGYTTCKPSDKIQSAIEERILSQ
CCP ----------------------------------------------------------------------------CCCC
SEG --------------------------------------------------------------------------------
PHDhtm --------------------------------------------------------------------------------
TMHMM --------------------------------------------------------------------------------
PSIBLAST --------------------------------------------------------------------------------
Pred2ary -EEEE---HH----HHHHHHHHH------------------EEE-----------EEEE--------HHHHHHHHHHH--
90 100 110 120 130 140 150 160
| | | | | | | |
Sequence EKEFRFLDENIEKIEEVKVIFWAIAINEKDESFKDYSLHSFIKEKNLLKESQAGGEWFIVDENKDKFEYLSQIFRQFRAP
CCP CCCCCCCCCCCCCCCCCC--------------------------------------------------------------
SEG ----------DDDDDDDDDD------------------------------------------------------------
PHDhtm --------------------------------------------------------------------------------
TMHMM --------------------------------------------------------------------------------
PSIBLAST --------------------------------------------------------------------------------
Pred2ary ----HHHHHHHHHHHHHHHHHHHHH---------HHHHHHHHHHH--H--------EEEE-----HHHHHHHHHHHHH--
Sequence SLFKK
CCP -----
SEG -----
PHDhtm -----
TMHMM -----
PSIBLAST -----
Pred2ary -----