MP Info

Info for MP050

This gene is gi number 1673700 from Mycoplasma pneumonia.

Available sections:

Potential Target Homologues
DNA Sequence
Codon Usage
Translation
Amino Acid Sequence
Protein Parameters
Predicted properties
Prediction details

Potential Target Homologues of MP050

Target	log10(PSIBLAST E)	% identical	% coverage (of MP gene)	Latest Status
1076B	-9.52	45.57	36.57	Solubility tested (S)
1139B	-8.70	27.45	76.69	Suggested work stop (77186 77186)
1142B	-7.22	62.75	43.97	Work stopped (Homology to 1636T)
1143B	-5.00	24.56	56.44	Override suggest work stop (phasing diffraction data)
1155B	-15.15	42.06	90.68	HSQC
1178B	-17.52	25.74	61.96	Solubility tested (S)
1179B	-7.00	40.00	50.00	Purified
1181B	-7.52	40.00	50.00	Purified
1184B	-8.70	58.90	55.73	Suggested work stop (77186 77186)
1192B	-16.70	44.09	62.84	Purified
1246B	-15.30	39.36	52.51	Suggested work stop (21701 21701 77186 77186)
1247B	-9.30	33.96	46.49	Override suggest work stop (a false positive)
1252B	-24.22	51.11	35.02	Work on hold
1357B	-6.00	32.26	49.21	NMR characterization
1636T	-6.70	57.38	71.76	In PDB (2BA2)
1653T	-6.52	34.74	94.06	Suggested work stop (77186 77186 77186 78218 78218)
1655T	-6.00	34.74	95.96	Work stopped (uncertainty in predicting domain boundaries)
1656T	-8.10	35.78	86.51	Work stopped (uncertainty in predicting domain boundaries)
1657T	-10.05	33.33	73.88	Suggested work stop (77186 77186)
1658T	-12.70	26.04	79.34	Work stopped (uncertainty in predicting domain boundaries)
1659T	-12.15	40.22	73.02	Override suggest work stop (No sequence homology to the known crystal structures )
1663T	-10.00	30.69	93.52	Suggested work stop (77186 77186 77186 78218 78218)
1681T	-10.00	70.27	74.00	Work stopped (uncertainty in predicting domain boundaries)
1687T	-7.70	27.50	86.33	Override suggest work stop (false positive)
1691T	-8.52	38.71	93.00	Work stopped (uncertainty in predicting domain boundaries)
1728T	-6.70	41.77	98.75	Work stopped (uncertainty in predicting domain boundaries)
1745T	-7.30	43.37	95.40	Work stopped (uncertainty in predicting domain boundaries)

MP050 DNA sequence

ATGGTAGAACTTGATGGTAAGTTTGCTACTAAAGCTGATTTAAAACGGGTTGAAGATAAAGTTGATGTTTTGTTTGAATT
GCAAAAAACGCAAGGTGAACAAATCAAGGTTCAAGGAAAACAAATCGAACAGTTAACTGAAACTGTTCAAAAACAGGGCG
AACAAATAAAGGAACTTCAAGTTCAGGTAAAAGCCCAAGGTGAAGAAATAAAAGAAATTAAAGTTGAACAAAAAGCTCAA
GGCCAAACCTTGCAGTTAATTCTGAAAGCACTTGAAGGAATAAACAAGCGACTAGATAATTTGGAATCGAAATAA

MP050 Codon Usage

(105 codons)
fields: [triplet] [frequency: per thousand] ([number])

UUU19.0(   2)  UCU0.0(   0)  UAU0.0(   0)  UGU0.0(   0)  
UUC0.0(   0)  UCC0.0(   0)  UAC0.0(   0)  UGC0.0(   0)  
UUA28.6(   3)  UCA0.0(   0)  UAA9.5(   1)  UGA0.0(   0)  
UUG38.1(   4)  UCG9.5(   1)  UAG0.0(   0)  UGG0.0(   0)  

CUU28.6(   3)  CCU0.0(   0)  CAU0.0(   0)  CGU0.0(   0)  
CUC0.0(   0)  CCC0.0(   0)  CAC0.0(   0)  CGC0.0(   0)  
CUA9.5(   1)  CCA0.0(   0)  CAA114.3(  12)  CGA9.5(   1)  
CUG9.5(   1)  CCG0.0(   0)  CAG38.1(   4)  CGG9.5(   1)  

AUU19.0(   2)  ACU28.6(   3)  AAU9.5(   1)  AGU0.0(   0)  
AUC19.0(   2)  ACC9.5(   1)  AAC9.5(   1)  AGC0.0(   0)  
AUA28.6(   3)  ACA0.0(   0)  AAA114.3(  12)  AGA0.0(   0)  
AUG9.5(   1)  ACG9.5(   1)  AAG38.1(   4)  AGG0.0(   0)  

GUU66.7(   7)  GCU28.6(   3)  GAU47.6(   5)  GGU28.6(   3)  
GUC0.0(   0)  GCC9.5(   1)  GAC0.0(   0)  GGC19.0(   2)  
GUA19.0(   2)  GCA9.5(   1)  GAA133.3(  14)  GGA19.0(   2)  
GUG0.0(   0)  GCG0.0(   0)  GAG0.0(   0)  GGG0.0(   0)

MP050 Translation

Note: This was generated using the standard codon usage table; UGA codons in MP/MP genes will show up as terminators ("*")

atggtagaacttgatggtaagtttgctactaaagctgatttaaaacgggttgaagataaa
 M  V  E  L  D  G  K  F  A  T  K  A  D  L  K  R  V  E  D  K 
gttgatgttttgtttgaattgcaaaaaacgcaaggtgaacaaatcaaggttcaaggaaaa
 V  D  V  L  F  E  L  Q  K  T  Q  G  E  Q  I  K  V  Q  G  K 
caaatcgaacagttaactgaaactgttcaaaaacagggcgaacaaataaaggaacttcaa
 Q  I  E  Q  L  T  E  T  V  Q  K  Q  G  E  Q  I  K  E  L  Q 
gttcaggtaaaagcccaaggtgaagaaataaaagaaattaaagttgaacaaaaagctcaa
 V  Q  V  K  A  Q  G  E  E  I  K  E  I  K  V  E  Q  K  A  Q 
ggccaaaccttgcagttaattctgaaagcacttgaaggaataaacaagcgactagataat
 G  Q  T  L  Q  L  I  L  K  A  L  E  G  I  N  K  R  L  D  N 
ttggaatcgaaataa
 L  E  S  K  *

MP050 AA Sequence

MVELDGKFATKADLKRVEDKVDVLFELQKTQGEQIKVQGKQIEQLTETVQKQGEQIKELQVQVKAQGEEIKEIKVEQKAQ
GQTLQLILKALEGINKRLDNLESK

MP050 Protein Parameters

This information was obtained using the Protein Parameters tool on the ExPASy Molecular Biology Server.

Number of amino acids: 104

Molecular weight: 11857.6

Theoretical pI: 5.61

Amino acid composition:

Ala (A)   5	  4.8%
Arg (R)   2	  1.9%
Asn (N)   2	  1.9%
Asp (D)   5	  4.8%
Cys (C)   0	  0.0%
Gln (Q)  16	 15.4%
Glu (E)  14	 13.5%
Gly (G)   7	  6.7%
His (H)   0	  0.0%
Ile (I)   7	  6.7%
Leu (L)  12	 11.5%
Lys (K)  16	 15.4%
Met (M)   1	  1.0%
Phe (F)   2	  1.9%
Pro (P)   0	  0.0%
Ser (S)   1	  1.0%
Thr (T)   5	  4.8%
Trp (W)   0	  0.0%
Tyr (Y)   0	  0.0%
Val (V)   9	  8.7%

Asx (B)   0	  0.0%
Glx (Z)   0	  0.0%
Xaa (X)   0	  0.0%

Total number of negatively charged residues (Asp + Glu): 19
Total number of positively charged residues (Arg + Lys): 18

Atomic composition:

Carbon      C	       520
Hydrogen    H	       884
Nitrogen    N	       144
Oxygen      O	       167
Sulfur      S	         1

Formula: C520H884N144O167S1
Total number of atoms: 1716

Extinction coefficients:

As there are no Trp, Tyr or Cys in the region considered, your protein
should not be visible by UV spectrophotometry.


Estimated half-life:

The N-terminal of the sequence considered is M (Met).

The estimated half-life is: 30 hours (mammalian reticulocytes, in vitro).
                            >20 hours (yeast, in vivo).
                            >10 hours (Escherichia coli, in vivo).


Instability index:

The instability index (II) is computed to be 40.79
This classifies the protein as unstable.



Aliphatic index: 101.15

Grand average of hydropathicity (GRAVY): -0.737

Predicted properties of MP050

Model	Percentage of MP Gene
Coiled Coil (CCP)	41
Disordered (SEG)	0
Transmembrane (PHDhtm)	0
Transmembrane (TMHMM)	0
Homologous to known structure (PSIBLAST)	0

MP050 Prediction Details

Sequence: Amino acid sequence.
CCP (C or -): coiled coil prediction from the ccp program (NCBI toolkit)
SEG (D or -): low complexity regions (possibly disordered) from SEG
PHDhtm (H or -): Transmembrane prediction from PHDhtm
TMHMM (H or -): Transmembrane prediction from TMHMM
PSIBLAST (3 or -): Regions potentially homologous to a protein of known 3D structure, according to PSIBLAST
Pred2ary (H, E, or -): Secondary structure prediction from Pred2ary

                 10        20        30        40        50        60        70        80
                  |         |         |         |         |         |         |         |
Sequence MVELDGKFATKADLKRVEDKVDVLFELQKTQGEQIKVQGKQIEQLTETVQKQGEQIKELQVQVKAQGEEIKEIKVEQKAQ
CCP      ----------------------------------CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC---
SEG      --------------------------------------------------------------------------------
PHDhtm   --------------------------------------------------------------------------------
TMHMM    --------------------------------------------------------------------------------
PSIBLAST --------------------------------------------------------------------------------
Pred2ary --------H-HHH-------HHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH

                 90       100
                  |         |
Sequence GQTLQLILKALEGINKRLDNLESK
CCP      ------------------------
SEG      ------------------------
PHDhtm   ------------------------
TMHMM    ------------------------
PSIBLAST ------------------------
Pred2ary HHHHHHHHHHHHHHHHHH------