Berkeley Structural Genomics Center

Info for MP541

This gene is gi number 1674238 from Mycoplasma pneumonia.

Available sections:


Potential Target Homologues of MP541

Targetlog10(PSIBLAST E)% identical% coverage (of MP gene)Latest Status
1021B-20.3016.7690.24Override suggest work stop (low sequencial homology to the known structures)
1022B-19.1518.7999.40In PDB (1G2I)

Back to Top


MP541 DNA sequence

ATGGATTTGCTTACAACCGCAAACAAAACGCCGCGAATCGCCAAATCACGTCCTGTTCGAATTGCCATCATTATAACGCA
GAAGACTAATGATCTGCACGCTACTGTACCCTGCTTTTTATGGCGCAAAGCAAGGTATGCTGTTGACCTGATTTCCGCTG
AAGCCAAAGCTAGCATTATGTTAGAGATGGGGATTCATGTGCGCTGTGACAACACTTTGTCCAAAACTAACTTTAACCAG
TATACCGCTGCTTTTATTCCCCATGGCAACACTACTAGGTTGGTGGAAATAGACAAACTAAGAAAGGACTTGGAGAAGTT
TGTCTATAAACCCAAGGGACCAATGCGCTGGTTGTTTAGCAGTGGTAATGGTGCTTGTGTTTTGAAGGAGTTTGACTTGA
TTGCCCCTGACCAATTAGTCACCGTTCAAAACGAAAAGGAAATGGTTAAACTTTTGGGAAAAAATTTCATCAAGCAACCA
GTACATGTGGACAAAAACATTATTAGTTGTGCCAATTCTTGTGGCTTGACTAAATTCTCCTTTAAGGTAATTGAAGAGCT
TTCAGGAATAGAACTAGCGCGCAAAACGGCGAATCTTGTTGACCATATCTACAAAGGATAA

Back to Top


MP541 Codon Usage

(207 codons)
fields: [triplet] [frequency: per thousand] ([number])

UUU33.8(   7)  UCU4.8(   1)  UAU14.5(   3)  UGU19.3(   4)  
UUC9.7(   2)  UCC14.5(   3)  UAC4.8(   1)  UGC4.8(   1)  
UUA14.5(   3)  UCA9.7(   2)  UAA4.8(   1)  UGA0.0(   0)  
UUG43.5(   9)  UCG0.0(   0)  UAG0.0(   0)  UGG9.7(   2)  

CUU19.3(   4)  CCU9.7(   2)  CAU19.3(   4)  CGU4.8(   1)  
CUC0.0(   0)  CCC14.5(   3)  CAC4.8(   1)  CGC19.3(   4)  
CUA9.7(   2)  CCA9.7(   2)  CAA14.5(   3)  CGA9.7(   2)  
CUG9.7(   2)  CCG4.8(   1)  CAG9.7(   2)  CGG0.0(   0)  

AUU48.3(  10)  ACU33.8(   7)  AAU24.2(   5)  AGU9.7(   2)  
AUC19.3(   4)  ACC14.5(   3)  AAC33.8(   7)  AGC9.7(   2)  
AUA14.5(   3)  ACA4.8(   1)  AAA62.8(  13)  AGA4.8(   1)  
AUG24.2(   5)  ACG14.5(   3)  AAG38.6(   8)  AGG9.7(   2)  

GUU29.0(   6)  GCU33.8(   7)  GAU9.7(   2)  GGU9.7(   2)  
GUC9.7(   2)  GCC24.2(   5)  GAC38.6(   8)  GGC9.7(   2)  
GUA14.5(   3)  GCA9.7(   2)  GAA29.0(   6)  GGA19.3(   4)  
GUG14.5(   3)  GCG9.7(   2)  GAG19.3(   4)  GGG4.8(   1)  

Back to Top


MP541 Translation

Note: This was generated using the standard codon usage table; UGA codons in MP/MP genes will show up as terminators ("*")

atggatttgcttacaaccgcaaacaaaacgccgcgaatcgccaaatcacgtcctgttcga
 M  D  L  L  T  T  A  N  K  T  P  R  I  A  K  S  R  P  V  R 
attgccatcattataacgcagaagactaatgatctgcacgctactgtaccctgcttttta
 I  A  I  I  I  T  Q  K  T  N  D  L  H  A  T  V  P  C  F  L 
tggcgcaaagcaaggtatgctgttgacctgatttccgctgaagccaaagctagcattatg
 W  R  K  A  R  Y  A  V  D  L  I  S  A  E  A  K  A  S  I  M 
ttagagatggggattcatgtgcgctgtgacaacactttgtccaaaactaactttaaccag
 L  E  M  G  I  H  V  R  C  D  N  T  L  S  K  T  N  F  N  Q 
tataccgctgcttttattccccatggcaacactactaggttggtggaaatagacaaacta
 Y  T  A  A  F  I  P  H  G  N  T  T  R  L  V  E  I  D  K  L 
agaaaggacttggagaagtttgtctataaacccaagggaccaatgcgctggttgtttagc
 R  K  D  L  E  K  F  V  Y  K  P  K  G  P  M  R  W  L  F  S 
agtggtaatggtgcttgtgttttgaaggagtttgacttgattgcccctgaccaattagtc
 S  G  N  G  A  C  V  L  K  E  F  D  L  I  A  P  D  Q  L  V 
accgttcaaaacgaaaaggaaatggttaaacttttgggaaaaaatttcatcaagcaacca
 T  V  Q  N  E  K  E  M  V  K  L  L  G  K  N  F  I  K  Q  P 
gtacatgtggacaaaaacattattagttgtgccaattcttgtggcttgactaaattctcc
 V  H  V  D  K  N  I  I  S  C  A  N  S  C  G  L  T  K  F  S 
tttaaggtaattgaagagctttcaggaatagaactagcgcgcaaaacggcgaatcttgtt
 F  K  V  I  E  E  L  S  G  I  E  L  A  R  K  T  A  N  L  V 
gaccatatctacaaaggataa
 D  H  I  Y  K  G  * 

Back to Top


MP541 AA Sequence

MDLLTTANKTPRIAKSRPVRIAIIITQKTNDLHATVPCFLWRKARYAVDLISAEAKASIMLEMGIHVRCDNTLSKTNFNQ
YTAAFIPHGNTTRLVEIDKLRKDLEKFVYKPKGPMRWLFSSGNGACVLKEFDLIAPDQLVTVQNEKEMVKLLGKNFIKQP
VHVDKNIISCANSCGLTKFSFKVIEELSGIELARKTANLVDHIYKG

Back to Top


MP541 Protein Parameters

This information was obtained using the Protein Parameters tool on the ExPASy Molecular Biology Server.

Number of amino acids: 206

Molecular weight: 23219.2

Theoretical pI: 9.51

Amino acid composition:

Ala (A)  16	  7.8%
Arg (R)  10	  4.9%
Asn (N)  12	  5.8%
Asp (D)  10	  4.9%
Cys (C)   5	  2.4%
Gln (Q)   5	  2.4%
Glu (E)  10	  4.9%
Gly (G)   9	  4.4%
His (H)   5	  2.4%
Ile (I)  17	  8.3%
Leu (L)  20	  9.7%
Lys (K)  21	 10.2%
Met (M)   5	  2.4%
Phe (F)   9	  4.4%
Pro (P)   8	  3.9%
Ser (S)  10	  4.9%
Thr (T)  14	  6.8%
Trp (W)   2	  1.0%
Tyr (Y)   4	  1.9%
Val (V)  14	  6.8%

Asx (B)   0	  0.0%
Glx (Z)   0	  0.0%
Xaa (X)   0	  0.0%

Total number of negatively charged residues (Asp + Glu): 20
Total number of positively charged residues (Arg + Lys): 31

Atomic composition:

Carbon      C	      1042
Hydrogen    H	      1692
Nitrogen    N	       286
Oxygen      O	       292
Sulfur      S	        10

Formula: C1042H1692N286O292S10
Total number of atoms: 3322

Extinction coefficients:

Conditions: 6.0 M guanidium hydrochloride
            0.02 M phosphate buffer
            pH 6.5

Extinction coefficients are in units of  M-1 cm-1 .

The first table lists values computed assuming ALL Cys 
residues appear as half cystines, whereas the second table 
assumes that NONE do. 

                      276     278     279     280     282
                       nm      nm      nm      nm      nm
Ext. coefficient    16890   17054   16940   16740   16240
Abs 0.1% (=1 g/l)   0.727   0.734   0.730   0.721   0.699



                      276     278     279     280     282
                       nm      nm      nm      nm      nm
Ext. coefficient    16600   16800   16700   16500   16000
Abs 0.1% (=1 g/l)   0.715   0.724   0.719   0.711   0.689


Estimated half-life:

The N-terminal of the sequence considered is M (Met).

The estimated half-life is: 30 hours (mammalian reticulocytes, in vitro).
                            >20 hours (yeast, in vivo).
                            >10 hours (Escherichia coli, in vivo).


Instability index:

The instability index (II) is computed to be 25.25
This classifies the protein as stable.



Aliphatic index: 97.52

Grand average of hydropathicity (GRAVY): -0.128

Back to Top


Predicted properties of MP541

ModelPercentage of MP Gene
Coiled Coil (CCP)0
Disordered (SEG)0
Transmembrane (PHDhtm)0
Transmembrane (TMHMM)0
Homologous to known structure (PSIBLAST)83

Back to Top


MP541 Prediction Details

Sequence: Amino acid sequence.
CCP (C or -): coiled coil prediction from the ccp program (NCBI toolkit)
SEG (D or -): low complexity regions (possibly disordered) from
SEG
PHDhtm (H or -): Transmembrane prediction from PHDhtm
TMHMM (H or -): Transmembrane prediction from TMHMM
PSIBLAST (3 or -): Regions potentially homologous to a protein of known 3D structure, according to PSIBLAST
Pred2ary (H, E, or -): Secondary structure prediction from Pred2ary

                 10        20        30        40        50        60        70        80
                  |         |         |         |         |         |         |         |
Sequence MDLLTTANKTPRIAKSRPVRIAIIITQKTNDLHATVPCFLWRKARYAVDLISAEAKASIMLEMGIHVRCDNTLSKTNFNQ
CCP      --------------------------------------------------------------------------------
SEG      --------------------------------------------------------------------------------
PHDhtm   --------------------------------------------------------------------------------
TMHMM    --------------------------------------------------------------------------------
PSIBLAST ---------------33333333333333333333333333333333333333333333333333333333333333333
Pred2ary --------------------EEEEEE------HHHHHHHHHHH----EEEEE-------------EEE------------

                 90       100       110       120       130       140       150       160
                  |         |         |         |         |         |         |         |
Sequence YTAAFIPHGNTTRLVEIDKLRKDLEKFVYKPKGPMRWLFSSGNGACVLKEFDLIAPDQLVTVQNEKEMVKLLGKNFIKQP
CCP      --------------------------------------------------------------------------------
SEG      --------------------------------------------------------------------------------
PHDhtm   --------------------------------------------------------------------------------
TMHMM    --------------------------------------------------------------------------------
PSIBLAST 33333333333333333333333333333333333333333333333333333333333333333333333333333333
Pred2ary --EEEE------HH------HHHHHHHHHHHHH----EEEE--HHHHHHHH-------------HHHHHHHH--------

                170       180       190       200
                  |         |         |         |
Sequence VHVDKNIISCANSCGLTKFSFKVIEELSGIELARKTANLVDHIYKG
CCP      ----------------------------------------------
SEG      ----------------------------------------------
PHDhtm   ----------------------------------------------
TMHMM    ----------------------------------------------
PSIBLAST 3333333333333333333333333333333333333333333333
Pred2ary EE----EEE------HHHHHHHHHHHH---HHHHHHHHH-------

Back to Top