Berkeley Structural Genomics Center

Info for MP056

This gene is gi number 1673707 from Mycoplasma pneumonia.

Available sections:


Potential Target Homologues of MP056

Targetlog10(PSIBLAST E)% identical% coverage (of MP gene)Latest Status
1180B-55.52100.00100.00Solubility tested (S)
1262B-9.0078.5716.87Purified
1388B-53.1551.3330.93Selected
1402B-55.0057.6923.04Expression tested
1604T-32.7039.80100.00Work stopped (uncertainty in predicting domain boundaries)
1605T-37.3040.54100.00Work stopped (uncertainty in predicting domain boundaries)
1606T-9.0062.9618.49Work stopped (uncertainty in predicting domain boundaries)
1618T-40.5246.9599.39Work stopped (uncertainty in predicting domain boundaries)
1619T-9.0081.4818.49Work stopped (uncertainty in predicting domain boundaries)
1662T-9.0570.3716.56Work stopped (uncertainty in predicting domain boundaries)
1665T-9.4074.0716.77Work stopped (uncertainty in predicting domain boundaries)
1669T-8.3055.5618.62Work stopped (uncertainty in predicting domain boundaries)
1672T-9.3085.1916.56Work stopped (uncertainty in predicting domain boundaries)
1677T-9.1574.0717.76Work stopped (uncertainty in predicting domain boundaries)
1680T-9.0577.7816.67Work stopped (uncertainty in predicting domain boundaries)
1684T-9.5277.7816.98Work stopped (uncertainty in predicting domain boundaries)
1685T-22.7057.1493.81Work stopped (uncertainty in predicting domain boundaries)
1689T-9.5262.9616.98Work stopped (uncertainty in predicting domain boundaries)

Back to Top


MP056 DNA sequence

ATGATGACTCAAGGTCCTAATCTAATTGGTATCCATACTAATACCAAGGAAAATGAAGAAACGCAAAAGTTTGTTAACTG
GTTCTTAAATACCAGTCTAACTTGAGATAACAACGAAAGCAAAACACCAGCGCAGTACTTTACCGAGTCTGCTTCTTACA
TCCTGCCTTTAAAAGAAACTTTTACCGGCTCTAACAACAAAGGTCAAAGCGGCAAGAATGACGGTAAGAATTCCAATAAC
ACCTTTAAAGCCAAAGCACTAGAGCTCTTTAAGGAACAGAGCGAAAACAAAATAGTGGGTTACAGTGATCCAAGCGATTT
CAGGGGTGGTAAATTCCGCGAATCAATTGGTTCTGCCTTTAACGCCACGGTCAATTCACACGTTGACTTTAATACTTTCG
TTGCTAACTTCCGTGCTAACTTAGGTTCTGGTTACGATAAATAG

Back to Top


MP056 Codon Usage

(148 codons)
fields: [triplet] [frequency: per thousand] ([number])

UUU47.3(   7)  UCU33.8(   5)  UAU0.0(   0)  UGU0.0(   0)  
UUC33.8(   5)  UCC6.8(   1)  UAC27.0(   4)  UGC0.0(   0)  
UUA20.3(   3)  UCA13.5(   2)  UAA0.0(   0)  UGA6.8(   1)  
UUG0.0(   0)  UCG0.0(   0)  UAG6.8(   1)  UGG6.8(   1)  

CUU0.0(   0)  CCU13.5(   2)  CAU6.8(   1)  CGU6.8(   1)  
CUC6.8(   1)  CCC0.0(   0)  CAC6.8(   1)  CGC6.8(   1)  
CUA20.3(   3)  CCA13.5(   2)  CAA20.3(   3)  CGA0.0(   0)  
CUG6.8(   1)  CCG0.0(   0)  CAG13.5(   2)  CGG0.0(   0)  

AUU13.5(   2)  ACU33.8(   5)  AAU60.8(   9)  AGU13.5(   2)  
AUC13.5(   2)  ACC33.8(   5)  AAC67.6(  10)  AGC27.0(   4)  
AUA6.8(   1)  ACA6.8(   1)  AAA54.1(   8)  AGA0.0(   0)  
AUG13.5(   2)  ACG13.5(   2)  AAG33.8(   5)  AGG6.8(   1)  

GUU20.3(   3)  GCU20.3(   3)  GAU27.0(   4)  GGU67.6(  10)  
GUC6.8(   1)  GCC20.3(   3)  GAC13.5(   2)  GGC13.5(   2)  
GUA0.0(   0)  GCA6.8(   1)  GAA54.1(   8)  GGA0.0(   0)  
GUG6.8(   1)  GCG6.8(   1)  GAG13.5(   2)  GGG0.0(   0)  

Back to Top


MP056 Translation

Note: This was generated using the standard codon usage table; UGA codons in MP/MP genes will show up as terminators ("*")

atgatgactcaaggtcctaatctaattggtatccatactaataccaaggaaaatgaagaa
 M  M  T  Q  G  P  N  L  I  G  I  H  T  N  T  K  E  N  E  E 
acgcaaaagtttgttaactggttcttaaataccagtctaacttgagataacaacgaaagc
 T  Q  K  F  V  N  W  F  L  N  T  S  L  T  *  D  N  N  E  S 
aaaacaccagcgcagtactttaccgagtctgcttcttacatcctgcctttaaaagaaact
 K  T  P  A  Q  Y  F  T  E  S  A  S  Y  I  L  P  L  K  E  T 
tttaccggctctaacaacaaaggtcaaagcggcaagaatgacggtaagaattccaataac
 F  T  G  S  N  N  K  G  Q  S  G  K  N  D  G  K  N  S  N  N 
acctttaaagccaaagcactagagctctttaaggaacagagcgaaaacaaaatagtgggt
 T  F  K  A  K  A  L  E  L  F  K  E  Q  S  E  N  K  I  V  G 
tacagtgatccaagcgatttcaggggtggtaaattccgcgaatcaattggttctgccttt
 Y  S  D  P  S  D  F  R  G  G  K  F  R  E  S  I  G  S  A  F 
aacgccacggtcaattcacacgttgactttaatactttcgttgctaacttccgtgctaac
 N  A  T  V  N  S  H  V  D  F  N  T  F  V  A  N  F  R  A  N 
ttaggttctggttacgataaatag
 L  G  S  G  Y  D  K  * 

Back to Top


MP056 AA Sequence

MMTQGPNLIGIHTNTKENEETQKFVNWFLNTSLTWDNNESKTPAQYFTESASYILPLKETFTGSNNKGQSGKNDGKNSNN
TFKAKALELFKEQSENKIVGYSDPSDFRGGKFRESIGSAFNATVNSHVDFNTFVANFRANLGSGYDK

Back to Top


MP056 Protein Parameters

This information was obtained using the Protein Parameters tool on the ExPASy Molecular Biology Server.

Number of amino acids: 147

Molecular weight: 16412.9

Theoretical pI: 6.74

Amino acid composition:

Ala (A)   8	  5.4%
Arg (R)   3	  2.0%
Asn (N)  19	 12.9%
Asp (D)   6	  4.1%
Cys (C)   0	  0.0%
Gln (Q)   5	  3.4%
Glu (E)  10	  6.8%
Gly (G)  12	  8.2%
His (H)   2	  1.4%
Ile (I)   5	  3.4%
Leu (L)   8	  5.4%
Lys (K)  13	  8.8%
Met (M)   2	  1.4%
Phe (F)  12	  8.2%
Pro (P)   4	  2.7%
Ser (S)  14	  9.5%
Thr (T)  13	  8.8%
Trp (W)   2	  1.4%
Tyr (Y)   4	  2.7%
Val (V)   5	  3.4%

Asx (B)   0	  0.0%
Glx (Z)   0	  0.0%
Xaa (X)   0	  0.0%

Total number of negatively charged residues (Asp + Glu): 16
Total number of positively charged residues (Arg + Lys): 16

Atomic composition:

Carbon      C	       724
Hydrogen    H	      1097
Nitrogen    N	       199
Oxygen      O	       235
Sulfur      S	         2

Formula: C724H1097N199O235S2
Total number of atoms: 2257

Extinction coefficients:

Conditions: 6.0 M guanidium hydrochloride
            0.02 M phosphate buffer
            pH 6.5

Extinction coefficients are in units of  M-1 cm-1 .

                      276     278     279     280     282
                       nm      nm      nm      nm      nm
Ext. coefficient    16600   16800   16700   16500   16000
Abs 0.1% (=1 g/l)   1.011   1.024   1.017   1.005   0.975


Estimated half-life:

The N-terminal of the sequence considered is M (Met).

The estimated half-life is: 30 hours (mammalian reticulocytes, in vitro).
                            >20 hours (yeast, in vivo).
                            >10 hours (Escherichia coli, in vivo).


Instability index:

The instability index (II) is computed to be 19.55
This classifies the protein as stable.



Aliphatic index: 49.80

Grand average of hydropathicity (GRAVY): -0.839

Back to Top


Predicted properties of MP056

ModelPercentage of MP Gene
Coiled Coil (CCP)0
Disordered (SEG)0
Transmembrane (PHDhtm)0
Transmembrane (TMHMM)0
Homologous to known structure (PSIBLAST)0

Back to Top


MP056 Prediction Details

Sequence: Amino acid sequence.
CCP (C or -): coiled coil prediction from the ccp program (NCBI toolkit)
SEG (D or -): low complexity regions (possibly disordered) from
SEG
PHDhtm (H or -): Transmembrane prediction from PHDhtm
TMHMM (H or -): Transmembrane prediction from TMHMM
PSIBLAST (3 or -): Regions potentially homologous to a protein of known 3D structure, according to PSIBLAST
Pred2ary (H, E, or -): Secondary structure prediction from Pred2ary

                 10        20        30        40        50        60        70        80
                  |         |         |         |         |         |         |         |
Sequence MMTQGPNLIGIHTNTKENEETQKFVNWFLNTSLTWDNNESKTPAQYFTESASYILPLKETFTGSNNKGQSGKNDGKNSNN
CCP      --------------------------------------------------------------------------------
SEG      --------------------------------------------------------------------------------
PHDhtm   --------------------------------------------------------------------------------
TMHMM    --------------------------------------------------------------------------------
PSIBLAST --------------------------------------------------------------------------------
Pred2ary -------EEEEE------HHHHHHHHHHH--------------HHHHH-----E----H---------------------

                 90       100       110       120       130       140
                  |         |         |         |         |         |
Sequence TFKAKALELFKEQSENKIVGYSDPSDFRGGKFRESIGSAFNATVNSHVDFNTFVANFRANLGSGYDK
CCP      -------------------------------------------------------------------
SEG      -------------------------------------------------------------------
PHDhtm   -------------------------------------------------------------------
TMHMM    -------------------------------------------------------------------
PSIBLAST -------------------------------------------------------------------
Pred2ary HHHHHHHHHHHHH----EEEE-----------HHHHHHHHHHH------HHHHHHHHHHHH------

Back to Top