Berkeley Structural Genomics Center

Info for MP085

This gene is gi number 1673739 from Mycoplasma pneumonia.

Available sections:


Potential Target Homologues of MP085

Targetlog10(PSIBLAST E)% identical% coverage (of MP gene)Latest Status
1982B-56.70100.00100.00Expression tested

Back to Top


MP085 DNA sequence

ATGAAAGTGATTAAGAAGCTCAATCTGCTCAATGAACTAACGATGCTGGTGTGCATCTTCTTCTTTGTGTGCACTATCTC
CCTAATTGGCATTGGCATTATGTATGACCTCATTAACAGAACTTCATTGAGTGCACCACGTCGTGATCCGATTTTTCGGA
ACCTCAACACAGTCTTAATTGTTTTAGGGGTGTTAGAAATCCTTTTAATGGTGGCCCAATTAGTTATGTCCAATATGGCA
GCCAACATTATTAACGAGGTTGCCGAAAACGTCGAGCAAAAGTTTGCTAAAGCCTTGAAATGATCACGTTTTCTGCCCTT
TGGTTTGCTCCAACTTTACTGTTACCATAAGATTAAATTGGTAACCCAAACCGATAATATATAA

Back to Top


MP085 Codon Usage

(128 codons)
fields: [triplet] [frequency: per thousand] ([number])

UUU39.1(   5)  UCU0.0(   0)  UAU7.8(   1)  UGU7.8(   1)  
UUC15.6(   2)  UCC15.6(   2)  UAC15.6(   2)  UGC15.6(   2)  
UUA39.1(   5)  UCA15.6(   2)  UAA7.8(   1)  UGA7.8(   1)  
UUG31.2(   4)  UCG0.0(   0)  UAG0.0(   0)  UGG0.0(   0)  

CUU15.6(   2)  CCU0.0(   0)  CAU7.8(   1)  CGU23.4(   3)  
CUC39.1(   5)  CCC7.8(   1)  CAC0.0(   0)  CGC0.0(   0)  
CUA15.6(   2)  CCA7.8(   1)  CAA31.2(   4)  CGA0.0(   0)  
CUG23.4(   3)  CCG7.8(   1)  CAG0.0(   0)  CGG7.8(   1)  

AUU78.1(  10)  ACU15.6(   2)  AAU31.2(   4)  AGU7.8(   1)  
AUC23.4(   3)  ACC15.6(   2)  AAC46.9(   6)  AGC0.0(   0)  
AUA7.8(   1)  ACA7.8(   1)  AAA31.2(   4)  AGA7.8(   1)  
AUG46.9(   6)  ACG7.8(   1)  AAG31.2(   4)  AGG0.0(   0)  

GUU23.4(   3)  GCU7.8(   1)  GAU15.6(   2)  GGU7.8(   1)  
GUC15.6(   2)  GCC31.2(   4)  GAC7.8(   1)  GGC15.6(   2)  
GUA7.8(   1)  GCA15.6(   2)  GAA23.4(   3)  GGA0.0(   0)  
GUG39.1(   5)  GCG0.0(   0)  GAG15.6(   2)  GGG7.8(   1)  

Back to Top


MP085 Translation

Note: This was generated using the standard codon usage table; UGA codons in MP/MP genes will show up as terminators ("*")

atgaaagtgattaagaagctcaatctgctcaatgaactaacgatgctggtgtgcatcttc
 M  K  V  I  K  K  L  N  L  L  N  E  L  T  M  L  V  C  I  F 
ttctttgtgtgcactatctccctaattggcattggcattatgtatgacctcattaacaga
 F  F  V  C  T  I  S  L  I  G  I  G  I  M  Y  D  L  I  N  R 
acttcattgagtgcaccacgtcgtgatccgatttttcggaacctcaacacagtcttaatt
 T  S  L  S  A  P  R  R  D  P  I  F  R  N  L  N  T  V  L  I 
gttttaggggtgttagaaatccttttaatggtggcccaattagttatgtccaatatggca
 V  L  G  V  L  E  I  L  L  M  V  A  Q  L  V  M  S  N  M  A 
gccaacattattaacgaggttgccgaaaacgtcgagcaaaagtttgctaaagccttgaaa
 A  N  I  I  N  E  V  A  E  N  V  E  Q  K  F  A  K  A  L  K 
tgatcacgttttctgccctttggtttgctccaactttactgttaccataagattaaattg
 *  S  R  F  L  P  F  G  L  L  Q  L  Y  C  Y  H  K  I  K  L 
gtaacccaaaccgataatatataa
 V  T  Q  T  D  N  I  * 

Back to Top


MP085 AA Sequence

MKVIKKLNLLNELTMLVCIFFFVCTISLIGIGIMYDLINRTSLSAPRRDPIFRNLNTVLIVLGVLEILLMVAQLVMSNMA
ANIINEVAENVEQKFAKALKWSRFLPFGLLQLYCYHKIKLVTQTDNI

Back to Top


MP085 Protein Parameters

This information was obtained using the Protein Parameters tool on the ExPASy Molecular Biology Server.

Number of amino acids: 127

Molecular weight: 14518.6

Theoretical pI: 9.33

Amino acid composition:

Ala (A)   7	  5.5%
Arg (R)   5	  3.9%
Asn (N)  10	  7.9%
Asp (D)   3	  2.4%
Cys (C)   3	  2.4%
Gln (Q)   4	  3.1%
Glu (E)   5	  3.9%
Gly (G)   4	  3.1%
His (H)   1	  0.8%
Ile (I)  14	 11.0%
Leu (L)  21	 16.5%
Lys (K)   8	  6.3%
Met (M)   6	  4.7%
Phe (F)   7	  5.5%
Pro (P)   3	  2.4%
Ser (S)   5	  3.9%
Thr (T)   6	  4.7%
Trp (W)   1	  0.8%
Tyr (Y)   3	  2.4%
Val (V)  11	  8.7%

Asx (B)   0	  0.0%
Glx (Z)   0	  0.0%
Xaa (X)   0	  0.0%

Total number of negatively charged residues (Asp + Glu): 8
Total number of positively charged residues (Arg + Lys): 13

Atomic composition:

Carbon      C	       669
Hydrogen    H	      1095
Nitrogen    N	       167
Oxygen      O	       172
Sulfur      S	         9

Formula: C669H1095N167O172S9
Total number of atoms: 2112

Extinction coefficients:

Conditions: 6.0 M guanidium hydrochloride
            0.02 M phosphate buffer
            pH 6.5

Extinction coefficients are in units of  M-1 cm-1 .

The first table lists values computed assuming ALL Cys 
residues appear as half cystines, whereas the second table 
assumes that NONE do. 

                      276     278     279     280     282
                       nm      nm      nm      nm      nm
Ext. coefficient     9895    9927    9815    9650    9320
Abs 0.1% (=1 g/l)   0.682   0.684   0.676   0.665   0.642



                      276     278     279     280     282
                       nm      nm      nm      nm      nm
Ext. coefficient     9750    9800    9695    9530    9200
Abs 0.1% (=1 g/l)   0.672   0.675   0.668   0.656   0.634


Estimated half-life:

The N-terminal of the sequence considered is M (Met).

The estimated half-life is: 30 hours (mammalian reticulocytes, in vitro).
                            >20 hours (yeast, in vivo).
                            >10 hours (Escherichia coli, in vivo).


Instability index:

The instability index (II) is computed to be 39.86
This classifies the protein as stable.



Aliphatic index: 138.11

Grand average of hydropathicity (GRAVY): 0.683

Back to Top


Predicted properties of MP085

ModelPercentage of MP Gene
Coiled Coil (CCP)0
Disordered (SEG)11
Transmembrane (PHDhtm)42
Transmembrane (TMHMM)36
Homologous to known structure (PSIBLAST)0

Back to Top


MP085 Prediction Details

Sequence: Amino acid sequence.
CCP (C or -): coiled coil prediction from the ccp program (NCBI toolkit)
SEG (D or -): low complexity regions (possibly disordered) from
SEG
PHDhtm (H or -): Transmembrane prediction from PHDhtm
TMHMM (H or -): Transmembrane prediction from TMHMM
PSIBLAST (3 or -): Regions potentially homologous to a protein of known 3D structure, according to PSIBLAST
Pred2ary (H, E, or -): Secondary structure prediction from Pred2ary

                 10        20        30        40        50        60        70        80
                  |         |         |         |         |         |         |         |
Sequence MKVIKKLNLLNELTMLVCIFFFVCTISLIGIGIMYDLINRTSLSAPRRDPIFRNLNTVLIVLGVLEILLMVAQLVMSNMA
CCP      --------------------------------------------------------------------------------
SEG      ---------------------------------------------------------DDDDDDDDDDDDDD---------
PHDhtm   -------------HHHHHHHHHHHHHHHHHHHHHHHH------------------HHHHHHHHHHHHHHHHHHHHHHH--
TMHMM    ------------HHHHHHHHHHHHHHHHHHHHHHH--------------HHHHHHHHHHHHHHHHHHHHHHH--------
PSIBLAST --------------------------------------------------------------------------------
Pred2ary -HHHHHH-----HHHEEEEEEEEEEEEEEE-EEEH-HH-------------H----HHHHHHHHHHHHHHHHHHHHHHHH

                 90       100       110       120
                  |         |         |         |
Sequence ANIINEVAENVEQKFAKALKWSRFLPFGLLQLYCYHKIKLVTQTDNI
CCP      -----------------------------------------------
SEG      -----------------------------------------------
PHDhtm   ---------------------------HHHHHH--------------
TMHMM    -----------------------------------------------
PSIBLAST -----------------------------------------------
Pred2ary HHHHHHHHHHHHHHHHHHH---------HHHHHHEEEEEEEEE----

Back to Top