Berkeley Structural Genomics Center

Target info for 1100B

This target is MP675 / MPN156, gi number 1674381 from Mycoplasma pneumoniae.

This gene has the annotation "ribosome binding factor A; similar to Swiss-Prot Accession Number P32731, from E. coli".

The target was selected as part of Igor's sets.

Available sections:


Experimental status of 1100B

Note: Dates prior to 10/24/01 may be inaccurate, due to conversion from a record-keeping system which tracked only the last experimental date, to a new system which keeps track of all dates. The user is the person who entered the data, not the person who did the experiment. This will also change in the future.

ExperimentResultUserExperiment Date
SelectedDoneigrigoriev2001-08-24
ClonedDoneabwaight2001-08-24
Expression testedDoneabwaight2001-11-12
Solubility testedSabwaight2001-11-12
PurifiedDonedewemmer2002-10-10
NMR characterizationDonedewemmer2002-10-10
HSQCDonedewemmer2002-10-10
NMR structureDonejmc2003-06-09
In PDB1PA4jmc2003-06-09
Suggested work stop13685 13941 13941jmc2002-08-26
Override suggest work stopRemote homolog sequence was deposited. Since homology was low, and NMR data collection was far along we decided it was worthwhile to continue and complete the structure. In the end the structural homology was correct, although the alignment was poor, in the correct structure based alignment the level of sequence idenity was very low.dewemmer2003-09-22

Back to Top


Potential MP Homologues of 1100B

MP genelog10(PSIBLAST E)% identical% coverage (of MP gene)
MP675 / MPN156-25.40100.00100.00

Back to Top


1100B DNA sequence

ATGGCTAGTTACAAAAAGGAACGTCTGGAAAACGACATTATTCGTTTAATTAACCGCACTGTTATTCACGAAATCTACAA
CGAAACGGTCAAAACCGGTCATGTAACCCACGTGAAACTATCGGATGATTTACTCCATGTAACAGTTTACCTAGACTGTT
ATAACCGTGAGCAAATTGACCGCGTGGTGGGTGCCTTTAACCAGGCCAAAGGGGTGTTTAGCCGCGTGTTAGCACACAAT
TTGTACTTAGCCAAAGCCGTGCAAATCCATTTTGTCAAGGACAAAGCAATTGATAACGCAATGCGCATTGAGTCTATCAT
CAACTCCCTTAAAAAATCAAAGCCTAATTAA

Back to Top


1100B Codon Usage

(117 codons)
fields: [triplet] [frequency: per thousand] ([number])

UUU25.6(   3)  UCU8.5(   1)  UAU8.5(   1)  UGU8.5(   1)  
UUC0.0(   0)  UCC8.5(   1)  UAC34.2(   4)  UGC0.0(   0)  
UUA34.2(   4)  UCA8.5(   1)  UAA8.5(   1)  UGA0.0(   0)  
UUG8.5(   1)  UCG8.5(   1)  UAG0.0(   0)  UGG0.0(   0)  

CUU8.5(   1)  CCU8.5(   1)  CAU25.6(   3)  CGU25.6(   3)  
CUC8.5(   1)  CCC0.0(   0)  CAC25.6(   3)  CGC34.2(   4)  
CUA17.1(   2)  CCA0.0(   0)  CAA17.1(   2)  CGA0.0(   0)  
CUG8.5(   1)  CCG0.0(   0)  CAG8.5(   1)  CGG0.0(   0)  

AUU59.8(   7)  ACU8.5(   1)  AAU17.1(   2)  AGU8.5(   1)  
AUC34.2(   4)  ACC17.1(   2)  AAC59.8(   7)  AGC8.5(   1)  
AUA0.0(   0)  ACA8.5(   1)  AAA68.4(   8)  AGA0.0(   0)  
AUG17.1(   2)  ACG8.5(   1)  AAG25.6(   3)  AGG0.0(   0)  

GUU17.1(   2)  GCU8.5(   1)  GAU25.6(   3)  GGU17.1(   2)  
GUC17.1(   2)  GCC34.2(   4)  GAC34.2(   4)  GGC0.0(   0)  
GUA17.1(   2)  GCA25.6(   3)  GAA34.2(   4)  GGA0.0(   0)  
GUG51.3(   6)  GCG0.0(   0)  GAG17.1(   2)  GGG8.5(   1)  

Back to Top


1100B Potential Cloning Problems

No UGA codons or (bad) restriction sites!

Back to Top


1100B Automatically Selected Primers

Note: These were generated using Hisao's algorithm, and do not take into account possible mispriming, self-complementarity, or requirements for mutations anywhere in the sequences. The -R1 primers are for the N-terminal end, and begin with an NdeI restriction site (CATATG). The -R2 primers are for the C-terminal end, and begin with a BamHI site (GGATCC) if the target has no other BamHI sites. If the target does have a BamHI site, the -R2 primer wil begin with a BglII site (AGATCT), unless the target has no BglII sites. If the target has both sites, the design program gives up and doesn't prepend a restriction site to the -R2 primer!

Predicted Tm was obtained using the Tm determination tool at the Virtual Genome Center.

Primer IDPredicted Tmsequence
1100B-R160.90CATATGGCTAGTTACAAAAAGGAACGTC
1100B-R260.70GGATCCTTAATTAGGCTTTGATTTTTTAAGGGA
1100B-R1063.80GGCGGTGGTGGCGGCATGGCTAGTTACAAAAAGGAACGTCTG
1100B-R1163.70GTTCTTCTCCTTTGCGCCCCTAATTAGGCTTTGATTTTTTAAGGGAGTTG

Back to Top


1100B Translation

Note: This was generated using the standard codon usage table; UGA codons in MP/MP genes will show up as terminators ("*")

atggctagttacaaaaaggaacgtctggaaaacgacattattcgtttaattaaccgcact
 M  A  S  Y  K  K  E  R  L  E  N  D  I  I  R  L  I  N  R  T 
gttattcacgaaatctacaacgaaacggtcaaaaccggtcatgtaacccacgtgaaacta
 V  I  H  E  I  Y  N  E  T  V  K  T  G  H  V  T  H  V  K  L 
tcggatgatttactccatgtaacagtttacctagactgttataaccgtgagcaaattgac
 S  D  D  L  L  H  V  T  V  Y  L  D  C  Y  N  R  E  Q  I  D 
cgcgtggtgggtgcctttaaccaggccaaaggggtgtttagccgcgtgttagcacacaat
 R  V  V  G  A  F  N  Q  A  K  G  V  F  S  R  V  L  A  H  N 
ttgtacttagccaaagccgtgcaaatccattttgtcaaggacaaagcaattgataacgca
 L  Y  L  A  K  A  V  Q  I  H  F  V  K  D  K  A  I  D  N  A 
atgcgcattgagtctatcatcaactcccttaaaaaatcaaagcctaattaa
 M  R  I  E  S  I  I  N  S  L  K  K  S  K  P  N  * 

Back to Top


1100B AA Sequence

MASYKKERLENDIIRLINRTVIHEIYNETVKTGHVTHVKLSDDLLHVTVYLDCYNREQIDRVVGAFNQAKGVFSRVLAHN
LYLAKAVQIHFVKDKAIDNAMRIESIINSLKKSKPN

Back to Top


1100B Protein Parameters

This information was obtained using the Protein Parameters tool on the ExPASy Molecular Biology Server.

Number of amino acids: 116

Molecular weight: 13389.5

Theoretical pI: 9.41

Amino acid composition:

Ala (A)   8	  6.9%
Arg (R)   7	  6.0%
Asn (N)   9	  7.8%
Asp (D)   7	  6.0%
Cys (C)   1	  0.9%
Gln (Q)   3	  2.6%
Glu (E)   6	  5.2%
Gly (G)   3	  2.6%
His (H)   6	  5.2%
Ile (I)  11	  9.5%
Leu (L)  10	  8.6%
Lys (K)  11	  9.5%
Met (M)   2	  1.7%
Phe (F)   3	  2.6%
Pro (P)   1	  0.9%
Ser (S)   6	  5.2%
Thr (T)   5	  4.3%
Trp (W)   0	  0.0%
Tyr (Y)   5	  4.3%
Val (V)  12	 10.3%

Asx (B)   0	  0.0%
Glx (Z)   0	  0.0%
Xaa (X)   0	  0.0%

Total number of negatively charged residues (Asp + Glu): 13
Total number of positively charged residues (Arg + Lys): 18

Atomic composition:

Carbon      C	       597
Hydrogen    H	       970
Nitrogen    N	       172
Oxygen      O	       171
Sulfur      S	         3

Formula: C597H970N172O171S3
Total number of atoms: 1913

Extinction coefficients:

Conditions: 6.0 M guanidium hydrochloride
            0.02 M phosphate buffer
            pH 6.5

Extinction coefficients are in units of  M-1 cm-1 .

The first table lists values computed assuming ALL Cys 
residues appear as half cystines, whereas the second table 
assumes that NONE do. 

                      276     278     279     280     282
                       nm      nm      nm      nm      nm
Ext. coefficient     7250    7000    6725    6400    6000
Abs 0.1% (=1 g/l)   0.541   0.523   0.502   0.478   0.448



                      276     278     279     280     282
                       nm      nm      nm      nm      nm
Ext. coefficient     7250    7000    6725    6400    6000
Abs 0.1% (=1 g/l)   0.541   0.523   0.502   0.478   0.448


Estimated half-life:

The N-terminal of the sequence considered is M (Met).

The estimated half-life is: 30 hours (mammalian reticulocytes, in vitro).
                            >20 hours (yeast, in vivo).
                            >10 hours (Escherichia coli, in vivo).


Instability index:

The instability index (II) is computed to be 13.37
This classifies the protein as stable.



Aliphatic index: 107.50

Grand average of hydropathicity (GRAVY): -0.273

Back to Top