Target info for 1108B

This gene has the annotation "hypothetical protein".

The target was selected as part of JMC's first set.

Available sections:

Experimental status of 1108B

Experiment	Result	User	Experiment Date
Selected	Done	jmc	2001-08-28
Cloned	Done	r_kim	2002-01-15
Expression tested	Done	r_kim	2002-01-15
Solubility tested	S	r_kim	2002-01-15
Purified	Done	r_kim	2002-02-26
Crystallized	Done	r_kim	2002-02-26
Diffraction quality crystals	Done	weiru	2002-03-28
Native diffraction data	Done	dhshin	2002-11-01
Phasing diffraction data	Done	dhshin	2002-06-10
Traceable map	Done	dhshin	2002-11-01
Crystal structure	Done	dhshin	2002-11-01
In PDB	1OZ9	dhshin	2003-05-14

Potential MP Homologues of 1108B

1108B DNA sequence

ATGAGCAGTACGAAAAGGCAAAAGAACAGAGTTCTGGTAAAACTGAAGAAGAGGAAAGTAAGGAAGGACAAGATTGAGAA
GTGGGCCGAGCTTGCCCTTTCGGCCCTCGGTCTCAATAACGTTGAACTCTCTGTTTACATAACAGATGACCAAGAGATAA
GGGAATTAAACAAAACTTATAGAAAGAAAGACAAGCCCACGGACGTCCTTTCCTTCCCAATGGGTGAGGAGTTCGGTGGA
TACAAAATACTCGGTGACGTTGTAATTTCTCAGGATACCGCGGAAAGACAGGCAAGGGAACTCGGTCATTCTCTTGAGGA
AGAGGTAAAGAGACTCATTGTTCACGGTATAGTTCACCTACTCGGATACGACCACGAAAAAGGCGGAGAGGAAGAAAAGA
AGTTCAGGGAACTGGAGAACTACGTACTGAGTAAACTCTCAAAAGCTTTGTAA

1108B Codon Usage

(151 codons)
fields: [triplet] [frequency: per thousand] ([number])

UUU0.0(   0)  UCU19.9(   3)  UAU6.6(   1)  UGU0.0(   0)  
UUC19.9(   3)  UCC6.6(   1)  UAC26.5(   4)  UGC0.0(   0)  
UUA6.6(   1)  UCA6.6(   1)  UAA6.6(   1)  UGA0.0(   0)  
UUG6.6(   1)  UCG6.6(   1)  UAG0.0(   0)  UGG6.6(   1)  

CUU26.5(   4)  CCU0.0(   0)  CAU6.6(   1)  CGU0.0(   0)  
CUC53.0(   8)  CCC6.6(   1)  CAC19.9(   3)  CGC0.0(   0)  
CUA6.6(   1)  CCA6.6(   1)  CAA13.2(   2)  CGA0.0(   0)  
CUG26.5(   4)  CCG0.0(   0)  CAG13.2(   2)  CGG0.0(   0)  

AUU19.9(   3)  ACU6.6(   1)  AAU6.6(   1)  AGU13.2(   2)  
AUC0.0(   0)  ACC6.6(   1)  AAC26.5(   4)  AGC6.6(   1)  
AUA26.5(   4)  ACA6.6(   1)  AAA59.6(   9)  AGA26.5(   4)  
AUG13.2(   2)  ACG13.2(   2)  AAG72.8(  11)  AGG39.7(   6)  

GUU39.7(   6)  GCU6.6(   1)  GAU13.2(   2)  GGU39.7(   6)  
GUC6.6(   1)  GCC19.9(   3)  GAC39.7(   6)  GGC6.6(   1)  
GUA33.1(   5)  GCA6.6(   1)  GAA59.6(   9)  GGA19.9(   3)  
GUG0.0(   0)  GCG6.6(   1)  GAG59.6(   9)  GGG0.0(   0)  

1108B Potential Cloning Problems

1108B Automatically Selected Primers

Note: These were generated using Hisao's algorithm, and do not take into account possible mispriming, self-complementarity, or requirements for mutations anywhere in the sequences. The -R1 primers are for the N-terminal end, and begin with an NdeI restriction site (CATATG). The -R2 primers are for the C-terminal end, and begin with a BamHI site (GGATCC) if the target has no other BamHI sites. If the target does have a BamHI site, the -R2 primer wil begin with a BglII site (AGATCT), unless the target has no BglII sites. If the target has both sites, the design program gives up and doesn't prepend a restriction site to the -R2 primer!

1108B Translation

Note: This was generated using the standard codon usage table; UGA codons in MP/MP genes will show up as terminators ("*")

atgagcagtacgaaaaggcaaaagaacagagttctggtaaaactgaagaagaggaaagta
 M  S  S  T  K  R  Q  K  N  R  V  L  V  K  L  K  K  R  K  V 
aggaaggacaagattgagaagtgggccgagcttgccctttcggccctcggtctcaataac
 R  K  D  K  I  E  K  W  A  E  L  A  L  S  A  L  G  L  N  N 
gttgaactctctgtttacataacagatgaccaagagataagggaattaaacaaaacttat
 V  E  L  S  V  Y  I  T  D  D  Q  E  I  R  E  L  N  K  T  Y 
agaaagaaagacaagcccacggacgtcctttccttcccaatgggtgaggagttcggtgga
 R  K  K  D  K  P  T  D  V  L  S  F  P  M  G  E  E  F  G  G 
tacaaaatactcggtgacgttgtaatttctcaggataccgcggaaagacaggcaagggaa
 Y  K  I  L  G  D  V  V  I  S  Q  D  T  A  E  R  Q  A  R  E 
ctcggtcattctcttgaggaagaggtaaagagactcattgttcacggtatagttcaccta
 L  G  H  S  L  E  E  E  V  K  R  L  I  V  H  G  I  V  H  L 
ctcggatacgaccacgaaaaaggcggagaggaagaaaagaagttcagggaactggagaac
 L  G  Y  D  H  E  K  G  G  E  E  E  K  K  F  R  E  L  E  N 
tacgtactgagtaaactctcaaaagctttgtaa
 Y  V  L  S  K  L  S  K  A  L  * 

1108B AA Sequence

MSSTKRQKNRVLVKLKKRKVRKDKIEKWAELALSALGLNNVELSVYITDDQEIRELNKTYRKKDKPTDVLSFPMGEEFGG
YKILGDVVISQDTAERQARELGHSLEEEVKRLIVHGIVHLLGYDHEKGGEEEKKFRELENYVLSKLSKAL

1108B Protein Parameters