Berkeley Structural Genomics Center

Target info for 1109B

This target is gi number 2983865 from Aquifex aeolicus.

This gene has the annotation "tRNA guanine-N1 methyltransferase".

The target was selected as part of JMC's first set.

Available sections:


Experimental status of 1109B

Note: Dates prior to 10/24/01 may be inaccurate, due to conversion from a record-keeping system which tracked only the last experimental date, to a new system which keeps track of all dates. The user is the person who entered the data, not the person who did the experiment. This will also change in the future.

ExperimentResultUserExperiment Date
SelectedDonejmc2001-08-28
ClonedDoner_kim2002-01-04
Expression testedDoner_kim2002-01-04
Solubility testedSr_kim2002-01-04
PurifiedDoner_kim2002-02-26
CrystallizedDoneweiru2002-05-08
Diffraction quality crystalsDoneweiru2002-05-30
Phasing diffraction dataDonedhshin2002-06-10
Traceable mapDonedhshin2002-06-10
Crystal structureDonedhshin2003-01-15
In PDB1OY5dhshin2003-05-14
Biochemical functionDonedhshin2003-01-23

Back to Top


Potential MP Homologues of 1109B

MP genelog10(PSIBLAST E)% identical% coverage (of MP gene)
MP183 / MPN659-81.0043.5481.32

Back to Top


1109B DNA sequence

TTGAGTTCTAATCCCCTCCGCTTCTTCGTCCTCACCATATTTCCCCATATAATCTCCTGTTACTCGGAGTACGGTATAGT
AAAGCAGGCTATAAAAAAGGGAAAAGTAGAAGTATATCCCATAGACCTTCGTGAGTTTGCACCAAAAGGACAAGTTGACG
ACGTCCCCTACGGCGGACTTCCAGGGATGGTTTTAAAACCAGAACCCATATACGAAGCCTACGATTACGTCGTTGAAAAT
TACGGAAAACCCTTCGTTTTAATTACCGAGCCCTGGGGAGAGAAACTAAACCAAAAGCTGGTAAACGAACTTTCTAAAAA
GGAAAGGATAATGATAATTTGCGGGCGGTACGAGGGAGTGGACGAGAGGGTTAAGAAAATCGTGGATATGGAAATTTCTC
TTGGAGACTTTATACTCTCGGGAGGTGAAATCGTAGCCCTCGCGGTAATTGACGCGGTGAGCAGGGTTCTCCCCGGAGTT
TTGAGTGAACCTCAGAGCATTCAGGAAGACAGTTTTCAAAACAGGTGGCTTGGCTACCCCGTTTACACGAGACCAAGGGA
ATACAGGGGGATGAAGGTTCCGGAAGAGCTCCTTTCAGGACACCACAAATTGATAGAACTCTGGAAGTTATGGCACAGGA
TAGAAAACACGGTAAAAAAGAGACCGGATTTAATACCTAAAGACTTGACAGAACTTGAAAAAGACATTTTAAATAGTATA
TTATCTGGAAAGTCATTCAAGGAATGGTTAAAAGAGCACAAGCACCTTCTTTAA

Back to Top


1109B Codon Usage

(258 codons)
fields: [triplet] [frequency: per thousand] ([number])

UUU15.5(   4)  UCU15.5(   4)  UAU3.9(   1)  UGU3.9(   1)  
UUC15.5(   4)  UCC3.9(   1)  UAC42.6(  11)  UGC3.9(   1)  
UUA27.1(   7)  UCA7.8(   2)  UAA3.9(   1)  UGA0.0(   0)  
UUG15.5(   4)  UCG7.8(   2)  UAG0.0(   0)  UGG19.4(   5)  

CUU34.9(   9)  CCU7.8(   2)  CAU3.9(   1)  CGU3.9(   1)  
CUC27.1(   7)  CCC34.9(   9)  CAC19.4(   5)  CGC3.9(   1)  
CUA3.9(   1)  CCA15.5(   4)  CAA11.6(   3)  CGA0.0(   0)  
CUG3.9(   1)  CCG7.8(   2)  CAG11.6(   3)  CGG3.9(   1)  

AUU23.3(   6)  ACU0.0(   0)  AAU11.6(   3)  AGU15.5(   4)  
AUC11.6(   3)  ACC7.8(   2)  AAC15.5(   4)  AGC7.8(   2)  
AUA50.4(  13)  ACA3.9(   1)  AAA50.4(  13)  AGA7.8(   2)  
AUG15.5(   4)  ACG7.8(   2)  AAG42.6(  11)  AGG27.1(   7)  

GUU34.9(   9)  GCU3.9(   1)  GAU11.6(   3)  GGU7.8(   2)  
GUC11.6(   3)  GCC7.8(   2)  GAC34.9(   9)  GGC7.8(   2)  
GUA27.1(   7)  GCA3.9(   1)  GAA65.9(  17)  GGA42.6(  11)  
GUG11.6(   3)  GCG7.8(   2)  GAG31.0(   8)  GGG11.6(   3)  

Back to Top


1109B Potential Cloning Problems

No UGA codons or (bad) restriction sites!

Back to Top


1109B Automatically Selected Primers

Note: These were generated using Hisao's algorithm, and do not take into account possible mispriming, self-complementarity, or requirements for mutations anywhere in the sequences. The -R1 primers are for the N-terminal end, and begin with an NdeI restriction site (CATATG). The -R2 primers are for the C-terminal end, and begin with a BamHI site (GGATCC) if the target has no other BamHI sites. If the target does have a BamHI site, the -R2 primer wil begin with a BglII site (AGATCT), unless the target has no BglII sites. If the target has both sites, the design program gives up and doesn't prepend a restriction site to the -R2 primer!

Predicted Tm was obtained using the Tm determination tool at the Virtual Genome Center.

Primer IDPredicted Tmsequence
1109B-R161.30CATATGAGTTCTAATCCCCTCCGC
1109B-R260.60GGATCCTTAAAGAAGGTGCTTGTGCTCTTT
1109B-R1063.30GGCGGTGGTGGCGGCATGAGTTCTAATCCCCTCCGCTT
1109B-R1164.90GTTCTTCTCCTTTGCGCCCCTAAAGAAGGTGCTTGTGCTCTTTTAACC

Back to Top


1109B Translation

Note: This was generated using the standard codon usage table; UGA codons in MP/MP genes will show up as terminators ("*")

ttgagttctaatcccctccgcttcttcgtcctcaccatatttccccatataatctcctgt
 L  S  S  N  P  L  R  F  F  V  L  T  I  F  P  H  I  I  S  C 
tactcggagtacggtatagtaaagcaggctataaaaaagggaaaagtagaagtatatccc
 Y  S  E  Y  G  I  V  K  Q  A  I  K  K  G  K  V  E  V  Y  P 
atagaccttcgtgagtttgcaccaaaaggacaagttgacgacgtcccctacggcggactt
 I  D  L  R  E  F  A  P  K  G  Q  V  D  D  V  P  Y  G  G  L 
ccagggatggttttaaaaccagaacccatatacgaagcctacgattacgtcgttgaaaat
 P  G  M  V  L  K  P  E  P  I  Y  E  A  Y  D  Y  V  V  E  N 
tacggaaaacccttcgttttaattaccgagccctggggagagaaactaaaccaaaagctg
 Y  G  K  P  F  V  L  I  T  E  P  W  G  E  K  L  N  Q  K  L 
gtaaacgaactttctaaaaaggaaaggataatgataatttgcgggcggtacgagggagtg
 V  N  E  L  S  K  K  E  R  I  M  I  I  C  G  R  Y  E  G  V 
gacgagagggttaagaaaatcgtggatatggaaatttctcttggagactttatactctcg
 D  E  R  V  K  K  I  V  D  M  E  I  S  L  G  D  F  I  L  S 
ggaggtgaaatcgtagccctcgcggtaattgacgcggtgagcagggttctccccggagtt
 G  G  E  I  V  A  L  A  V  I  D  A  V  S  R  V  L  P  G  V 
ttgagtgaacctcagagcattcaggaagacagttttcaaaacaggtggcttggctacccc
 L  S  E  P  Q  S  I  Q  E  D  S  F  Q  N  R  W  L  G  Y  P 
gtttacacgagaccaagggaatacagggggatgaaggttccggaagagctcctttcagga
 V  Y  T  R  P  R  E  Y  R  G  M  K  V  P  E  E  L  L  S  G 
caccacaaattgatagaactctggaagttatggcacaggatagaaaacacggtaaaaaag
 H  H  K  L  I  E  L  W  K  L  W  H  R  I  E  N  T  V  K  K 
agaccggatttaatacctaaagacttgacagaacttgaaaaagacattttaaatagtata
 R  P  D  L  I  P  K  D  L  T  E  L  E  K  D  I  L  N  S  I 
ttatctggaaagtcattcaaggaatggttaaaagagcacaagcaccttctttaa
 L  S  G  K  S  F  K  E  W  L  K  E  H  K  H  L  L  * 

Back to Top


1109B AA Sequence

MSSNPLRFFVLTIFPHIISCYSEYGIVKQAIKKGKVEVYPIDLREFAPKGQVDDVPYGGLPGMVLKPEPIYEAYDYVVEN
YGKPFVLITEPWGEKLNQKLVNELSKKERIMIICGRYEGVDERVKKIVDMEISLGDFILSGGEIVALAVIDAVSRVLPGV
LSEPQSIQEDSFQNRWLGYPVYTRPREYRGMKVPEELLSGHHKLIELWKLWHRIENTVKKRPDLIPKDLTELEKDILNSI
LSGKSFKEWLKEHKHLL

Back to Top


1109B Protein Parameters

This information was obtained using the Protein Parameters tool on the ExPASy Molecular Biology Server.

Number of amino acids: 257

Molecular weight: 29651.5

Theoretical pI: 6.62

Amino acid composition:

Ala (A)   6	  2.3%
Arg (R)  12	  4.7%
Asn (N)   7	  2.7%
Asp (D)  12	  4.7%
Cys (C)   2	  0.8%
Gln (Q)   6	  2.3%
Glu (E)  25	  9.7%
Gly (G)  18	  7.0%
His (H)   6	  2.3%
Ile (I)  22	  8.6%
Leu (L)  28	 10.9%
Lys (K)  24	  9.3%
Met (M)   5	  1.9%
Phe (F)   8	  3.1%
Pro (P)  17	  6.6%
Ser (S)  15	  5.8%
Thr (T)   5	  1.9%
Trp (W)   5	  1.9%
Tyr (Y)  12	  4.7%
Val (V)  22	  8.6%

Asx (B)   0	  0.0%
Glx (Z)   0	  0.0%
Xaa (X)   0	  0.0%

Total number of negatively charged residues (Asp + Glu): 37
Total number of positively charged residues (Arg + Lys): 36

Atomic composition:

Carbon      C	      1363
Hydrogen    H	      2147
Nitrogen    N	       347
Oxygen      O	       377
Sulfur      S	         7

Formula: C1363H2147N347O377S7
Total number of atoms: 4241

Extinction coefficients:

Conditions: 6.0 M guanidium hydrochloride
            0.02 M phosphate buffer
            pH 6.5

Extinction coefficients are in units of  M-1 cm-1 .

The first table lists values computed assuming ALL Cys 
residues appear as half cystines, whereas the second table 
assumes that NONE do. 

                      276     278     279     280     282
                       nm      nm      nm      nm      nm
Ext. coefficient    44545   44927   44560   43930   42520
Abs 0.1% (=1 g/l)   1.502   1.515   1.503   1.482   1.434



                      276     278     279     280     282
                       nm      nm      nm      nm      nm
Ext. coefficient    44400   44800   44440   43810   42400
Abs 0.1% (=1 g/l)   1.497   1.511   1.499   1.477   1.430


Estimated half-life:

The N-terminal of the sequence considered is M (Met).

The estimated half-life is: 30 hours (mammalian reticulocytes, in vitro).
                            >20 hours (yeast, in vivo).
                            >10 hours (Escherichia coli, in vivo).


Instability index:

The instability index (II) is computed to be 40.06
This classifies the protein as unstable.



Aliphatic index: 103.04

Grand average of hydropathicity (GRAVY): -0.258

Back to Top