|
|
This gene has the annotation "conserved hypothetical protein".
The target was selected as part of JMC's first set.
Available sections:
| Experiment | Result | User | Experiment Date |
|---|---|---|---|
| Selected | Done | jmc | 2001-08-28 |
| Cloned | Done | r_kim | 2002-03-02 |
| Expression tested | Done | r_kim | 2002-03-02 |
| Solubility tested | S | r_kim | 2002-03-02 |
| Purified | Done | r_kim | 2003-12-01 |
| Crystallized | Done | dhshin | 2003-12-02 |
| Diffraction quality crystals | Done | dhshin | 2004-01-27 |
| Native diffraction data | Done | dhshin | 2004-01-27 |
| Phasing diffraction data | Done | dhshin | 2004-01-27 |
| Traceable map | Done | dhshin | 2004-02-06 |
| Crystal structure | Done | dhshin | 2005-04-13 |
| In PDB | 1SUW 1Z0S 1Z0U 1Z0Z | dhshin | 2005-04-13 |
| MP gene | log10(PSIBLAST E) | % identical | % coverage (of MP gene) |
|---|---|---|---|
| MP566 / MPN267 | -46.30 | 21.05 | 99.20 |
ATGAGGGCCGCAGTGGTTTACAAAACCGATGGTCACGTGAAGAGGATTGAGGAAGCTTTGAAAAGGCTGGAGGTTGAGGT TGAGCTCTTCAACCAGCCTTCAGAAGAGCTTGAGAATTTTGACTTCATTGTGAGTGTTGGGGGAGACGGGACAATTCTGA GAATACTGCAGAAGCTGAAGCGCTGCCCGCCCATTTTCGGGATAAACACCGGAAGAGTCGGTCTGCTTACCCACGCCAGC CCTGAAAACTTTGAGGTTGAGCTTAAAAAGGCGGTGGAGAAGTTTGAGGTTGAGAGGTTTCCGAGAGTAAGCTGCTCCGC AATGCCCGATGTTCTTGCCCTCAACGAGATTGCCGTTTTGAGCAGAAAACCGGCGAAGATGATAGACGTCGCTTTGAGGG TCGATGGCGTGGAGGTGGACAGAATAAGGTGCGACGGCTTTATTGTTGCAACTCAGATTGGCTCCACAGGCTACGCCTTC TCTGCTGGAGGGCCGGTAGTTGAGCCCTACCTCGAATGCTTCATCCTCATCCCCATTGCACCCTTCCGCTTCGGCTGGAA GCCCTACGTGGTCAGCATGGAGAGGAAAATTGAGGTTATTGCTGAGAAAGCCATTGTGGTGGCTGATGGGCAGAAGAGCG TGGATTTTGATGGTGAGATAACCATAGAAAAGTCGGAATTTCCGGCTGTGTTCTTCAAAAACGAGAAAAGGTTCAGGAAC CTTTTCGGGAAAGTTAGGAGCATAGGTTAA
(250 codons) fields: [triplet] [frequency: per thousand] ([number]) UUU28.0( 7) UCU4.0( 1) UAU0.0( 0) UGU0.0( 0) UUC44.0( 11) UCC8.0( 2) UAC16.0( 4) UGC16.0( 4) UUA0.0( 0) UCA4.0( 1) UAA4.0( 1) UGA0.0( 0) UUG12.0( 3) UCG4.0( 1) UAG0.0( 0) UGG4.0( 1) CUU20.0( 5) CCU8.0( 2) CAU0.0( 0) CGU0.0( 0) CUC16.0( 4) CCC24.0( 6) CAC8.0( 2) CGC8.0( 2) CUA0.0( 0) CCA0.0( 0) CAA0.0( 0) CGA0.0( 0) CUG20.0( 5) CCG20.0( 5) CAG16.0( 4) CGG0.0( 0) AUU44.0( 11) ACU4.0( 1) AAU4.0( 1) AGU4.0( 1) AUC8.0( 2) ACC16.0( 4) AAC24.0( 6) AGC24.0( 6) AUA28.0( 7) ACA8.0( 2) AAA36.0( 9) AGA20.0( 5) AUG16.0( 4) ACG0.0( 0) AAG36.0( 9) AGG40.0( 10) GUU48.0( 12) GCU24.0( 6) GAU24.0( 6) GGU16.0( 4) GUC16.0( 4) GCC24.0( 6) GAC20.0( 5) GGC20.0( 5) GUA8.0( 2) GCA16.0( 4) GAA24.0( 6) GGA12.0( 3) GUG44.0( 11) GCG8.0( 2) GAG76.0( 19) GGG24.0( 6)
Note: These were generated using Hisao's algorithm, and do not take into account possible mispriming, self-complementarity, or requirements for mutations anywhere in the sequences. The -R1 primers are for the N-terminal end, and begin with an NdeI restriction site (CATATG). The -R2 primers are for the C-terminal end, and begin with a BamHI site (GGATCC) if the target has no other BamHI sites. If the target does have a BamHI site, the -R2 primer wil begin with a BglII site (AGATCT), unless the target has no BglII sites. If the target has both sites, the design program gives up and doesn't prepend a restriction site to the -R2 primer!
Predicted Tm was obtained using the Tm determination tool at the Virtual Genome Center.
| Primer ID | Predicted Tm | sequence |
|---|---|---|
| 1114B-R1 | 61.70 | CATATGAGGGCCGCAGTGG |
| 1114B-R2 | 62.80 | GGATCCTTAACCTATGCTCCTAACTTTCCCG |
| 1114B-R10 | 63.90 | GGCGGTGGTGGCGGCATGAGGGCCGCAGTGGTT |
| 1114B-R11 | 63.20 | GTTCTTCTCCTTTGCGCCCCTAACCTATGCTCCTAACTTTCCCGA |
Note: This was generated using the standard codon usage table; UGA codons in MP/MP genes will show up as terminators ("*")
atgagggccgcagtggtttacaaaaccgatggtcacgtgaagaggattgaggaagctttg M R A A V V Y K T D G H V K R I E E A L aaaaggctggaggttgaggttgagctcttcaaccagccttcagaagagcttgagaatttt K R L E V E V E L F N Q P S E E L E N F gacttcattgtgagtgttgggggagacgggacaattctgagaatactgcagaagctgaag D F I V S V G G D G T I L R I L Q K L K cgctgcccgcccattttcgggataaacaccggaagagtcggtctgcttacccacgccagc R C P P I F G I N T G R V G L L T H A S cctgaaaactttgaggttgagcttaaaaaggcggtggagaagtttgaggttgagaggttt P E N F E V E L K K A V E K F E V E R F ccgagagtaagctgctccgcaatgcccgatgttcttgccctcaacgagattgccgttttg P R V S C S A M P D V L A L N E I A V L agcagaaaaccggcgaagatgatagacgtcgctttgagggtcgatggcgtggaggtggac S R K P A K M I D V A L R V D G V E V D agaataaggtgcgacggctttattgttgcaactcagattggctccacaggctacgccttc R I R C D G F I V A T Q I G S T G Y A F tctgctggagggccggtagttgagccctacctcgaatgcttcatcctcatccccattgca S A G G P V V E P Y L E C F I L I P I A cccttccgcttcggctggaagccctacgtggtcagcatggagaggaaaattgaggttatt P F R F G W K P Y V V S M E R K I E V I gctgagaaagccattgtggtggctgatgggcagaagagcgtggattttgatggtgagata A E K A I V V A D G Q K S V D F D G E I accatagaaaagtcggaatttccggctgtgttcttcaaaaacgagaaaaggttcaggaac T I E K S E F P A V F F K N E K R F R N cttttcgggaaagttaggagcataggttaa L F G K V R S I G *
MRAAVVYKTDGHVKRIEEALKRLEVEVELFNQPSEELENFDFIVSVGGDGTILRILQKLKRCPPIFGINTGRVGLLTHAS PENFEVELKKAVEKFEVERFPRVSCSAMPDVLALNEIAVLSRKPAKMIDVALRVDGVEVDRIRCDGFIVATQIGSTGYAF SAGGPVVEPYLECFILIPIAPFRFGWKPYVVSMERKIEVIAEKAIVVADGQKSVDFDGEITIEKSEFPAVFFKNEKRFRN LFGKVRSIG
This information was obtained using the Protein Parameters tool on the ExPASy Molecular Biology Server.
Number of amino acids: 249
Molecular weight: 27868.4
Theoretical pI: 6.25
Amino acid composition:
Ala (A) 18 7.2%
Arg (R) 17 6.8%
Asn (N) 7 2.8%
Asp (D) 11 4.4%
Cys (C) 4 1.6%
Gln (Q) 4 1.6%
Glu (E) 25 10.0%
Gly (G) 18 7.2%
His (H) 2 0.8%
Ile (I) 20 8.0%
Leu (L) 17 6.8%
Lys (K) 18 7.2%
Met (M) 4 1.6%
Phe (F) 18 7.2%
Pro (P) 13 5.2%
Ser (S) 12 4.8%
Thr (T) 7 2.8%
Trp (W) 1 0.4%
Tyr (Y) 4 1.6%
Val (V) 29 11.6%
Asx (B) 0 0.0%
Glx (Z) 0 0.0%
Xaa (X) 0 0.0%
Total number of negatively charged residues (Asp + Glu): 36
Total number of positively charged residues (Arg + Lys): 35
Atomic composition:
Carbon C 1266
Hydrogen H 2016
Nitrogen N 334
Oxygen O 356
Sulfur S 8
Formula: C1266H2016N334O356S8
Total number of atoms: 3980
Extinction coefficients:
Conditions: 6.0 M guanidium hydrochloride
0.02 M phosphate buffer
pH 6.5
Extinction coefficients are in units of M-1 cm-1 .
The first table lists values computed assuming ALL Cys
residues appear as half cystines, whereas the second table
assumes that NONE do.
276 278 279 280 282
nm nm nm nm nm
Ext. coefficient 11490 11454 11280 11050 10640
Abs 0.1% (=1 g/l) 0.412 0.411 0.405 0.397 0.382
276 278 279 280 282
nm nm nm nm nm
Ext. coefficient 11200 11200 11040 10810 10400
Abs 0.1% (=1 g/l) 0.402 0.402 0.396 0.388 0.373
Estimated half-life:
The N-terminal of the sequence considered is M (Met).
The estimated half-life is: 30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Instability index:
The instability index (II) is computed to be 42.54
This classifies the protein as unstable.
Aliphatic index: 98.96
Grand average of hydropathicity (GRAVY): 0.043