|
|
This gene has the annotation "ribonuclease HII (rnhB)".
The target was selected as part of Igor's sets.
Available sections:
| Experiment | Result | User | Experiment Date |
|---|---|---|---|
| Selected | Done | jmc | 2001-08-24 |
| Cloned | Done | abwaight | 2001-08-24 |
| Expression tested | Done | abwaight | 2001-08-24 |
| Solubility tested | S | abwaight | 2001-08-24 |
| Purified | Done | abwaight | 2001-08-24 |
| Crystallized | Done | abwaight | 2001-08-24 |
| Diffraction quality crystals | Done | abwaight | 2001-08-24 |
| Phasing diffraction data | Done | abwaight | 2001-08-24 |
| Traceable map | Done | abwaight | 2001-08-24 |
| Crystal structure | Done | abwaight | 2001-08-24 |
| In PDB | 1EKE | abwaight | 2001-08-24 |
| MP gene | log10(PSIBLAST E) | % identical | % coverage (of MP gene) |
|---|---|---|---|
| MP036 | -11.70 | 19.29 | 60.87 |
ATGATAATTATTGGTATTGATGAAGCTGGAAGAGGGCCTGTTTTGGGTCCAATGGTTGTTTGTGCTTTTGCAATTGAAAA AGAGAGAGAAGAGGAATTAAAGAAATTGGGAGTTAAAGATAGTAAGGAGCTAACTAAAAATAAAAGGGCTTATCTAAAAA AGTTACTTGAAAATTTGGGTTATGTAGAAAAACGTATCTTAGAAGCAGAGGAAATAAACCAATTAATGAACTCAATAAAC TTAAATGATATTGAAATTAACGCCTTTTCCAAGGTTGCTAAAAATTTGATAGAAAAGTTGAATATAAGGGATGATGAAAT TGAAATTTATATTGATGCATGCAGTACAAACACTAAAAAATTTGAGGATAGTTTTAAAGATAAGATAGAGGATATAATTA AAGAAAGAAATTTAAACATAAAAATTATAGCTGAACATAAGGCAGATGCTAAGTATCCTGTTGTTTCAGCTGCCTCAATA ATAGCAAAGGCAGAACGGGATGAGATAATAGACTACTACAAAAAAATTTATGGAGATATTGGGAGCGGTTATCCATCAGA CCCAAAAACTATAAAGTTTCTTGAAGATTACTTTAAAAAGCATAAAAAACTTCCTGATATTGCAAGAACTCACTGGAAAA CATGTAAAAGGATATTGGATAAATCAAAACAGACAAAGCTAATTATAGAGTGA
(231 codons) fields: [triplet] [frequency: per thousand] ([number]) UUU26.0( 6) UCU0.0( 0) UAU26.0( 6) UGU8.7( 2) UUC0.0( 0) UCC4.3( 1) UAC13.0( 3) UGC4.3( 1) UUA26.0( 6) UCA21.6( 5) UAA0.0( 0) UGA4.3( 1) UUG26.0( 6) UCG0.0( 0) UAG0.0( 0) UGG4.3( 1) CUU13.0( 3) CCU13.0( 3) CAU8.7( 2) CGU4.3( 1) CUC0.0( 0) CCC0.0( 0) CAC4.3( 1) CGC0.0( 0) CUA13.0( 3) CCA13.0( 3) CAA4.3( 1) CGA0.0( 0) CUG0.0( 0) CCG0.0( 0) CAG4.3( 1) CGG4.3( 1) AUU64.9( 15) ACU17.3( 4) AAU26.0( 6) AGU13.0( 3) AUC4.3( 1) ACC0.0( 0) AAC26.0( 6) AGC4.3( 1) AUA69.3( 16) ACA13.0( 3) AAA99.6( 23) AGA17.3( 4) AUG13.0( 3) ACG0.0( 0) AAG51.9( 12) AGG13.0( 3) GUU30.3( 7) GCU30.3( 7) GAU64.9( 15) GGU17.3( 4) GUC0.0( 0) GCC8.7( 2) GAC8.7( 2) GGC0.0( 0) GUA4.3( 1) GCA30.3( 7) GAA69.3( 16) GGA13.0( 3) GUG0.0( 0) GCG0.0( 0) GAG34.6( 8) GGG8.7( 2)
Note: These were generated using Hisao's algorithm, and do not take into account possible mispriming, self-complementarity, or requirements for mutations anywhere in the sequences. The -R1 primers are for the N-terminal end, and begin with an NdeI restriction site (CATATG). The -R2 primers are for the C-terminal end, and begin with a BamHI site (GGATCC) if the target has no other BamHI sites. If the target does have a BamHI site, the -R2 primer wil begin with a BglII site (AGATCT), unless the target has no BglII sites. If the target has both sites, the design program gives up and doesn't prepend a restriction site to the -R2 primer!
Predicted Tm was obtained using the Tm determination tool at the Virtual Genome Center.
| Primer ID | Predicted Tm | sequence |
|---|---|---|
| 1011B-R1 | 62.50 | CATATGATAATTATTGGTATTGATGAAGCTGG |
| 1011B-R2 | 60.20 | GGATCCTTATCACTCTATTAGCTTTGTCTGTTTTGAT |
| 1011B-R3 | 60.00 | GGATCCTTACTCTATAATTAGCTTTGTCTGTTTTGATTTAT |
| 1011B-R10 | 63.80 | GGCGGTGGTGGCGGCATGATAATTATTGGTATTGATGAAGCTGGA |
| 1011B-R11 | 63.30 | GTTCTTCTCCTTTGCGCCCCTACTCTATAATTAGCTTTGTCTGTTTTGATTTATCC |
Note: This was generated using the standard codon usage table; UGA codons in MP/MP genes will show up as terminators ("*")
atgataattattggtattgatgaagctggaagagggcctgttttgggtccaatggttgtt M I I I G I D E A G R G P V L G P M V V tgtgcttttgcaattgaaaaagagagagaagaggaattaaagaaattgggagttaaagat C A F A I E K E R E E E L K K L G V K D agtaaggagctaactaaaaataaaagggcttatctaaaaaagttacttgaaaatttgggt S K E L T K N K R A Y L K K L L E N L G tatgtagaaaaacgtatcttagaagcagaggaaataaaccaattaatgaactcaataaac Y V E K R I L E A E E I N Q L M N S I N ttaaatgatattgaaattaacgccttttccaaggttgctaaaaatttgatagaaaagttg L N D I E I N A F S K V A K N L I E K L aatataagggatgatgaaattgaaatttatattgatgcatgcagtacaaacactaaaaaa N I R D D E I E I Y I D A C S T N T K K tttgaggatagttttaaagataagatagaggatataattaaagaaagaaatttaaacata F E D S F K D K I E D I I K E R N L N I aaaattatagctgaacataaggcagatgctaagtatcctgttgtttcagctgcctcaata K I I A E H K A D A K Y P V V S A A S I atagcaaaggcagaacgggatgagataatagactactacaaaaaaatttatggagatatt I A K A E R D E I I D Y Y K K I Y G D I gggagcggttatccatcagacccaaaaactataaagtttcttgaagattactttaaaaag G S G Y P S D P K T I K F L E D Y F K K cataaaaaacttcctgatattgcaagaactcactggaaaacatgtaaaaggatattggat H K K L P D I A R T H W K T C K R I L D aaatcaaaacagacaaagctaattatagagtga K S K Q T K L I I E *
MIIIGIDEAGRGPVLGPMVVCAFAIEKEREEELKKLGVKDSKELTKNKRAYLKKLLENLGYVEKRILEAEEINQLMNSIN LNDIEINAFSKVAKNLIEKLNIRDDEIEIYIDACSTNTKKFEDSFKDKIEDIIKERNLNIKIIAEHKADAKYPVVSAASI IAKAERDEIIDYYKKIYGDIGSGYPSDPKTIKFLEDYFKKHKKLPDIARTHWKTCKRILDKSKQTKLIIE
This information was obtained using the Protein Parameters tool on the ExPASy Molecular Biology Server.
Number of amino acids: 230
Molecular weight: 26505.8
Theoretical pI: 8.49
Amino acid composition:
Ala (A) 16 7.0%
Arg (R) 9 3.9%
Asn (N) 12 5.2%
Asp (D) 17 7.4%
Cys (C) 3 1.3%
Gln (Q) 2 0.9%
Glu (E) 24 10.4%
Gly (G) 9 3.9%
His (H) 3 1.3%
Ile (I) 32 13.9%
Leu (L) 18 7.8%
Lys (K) 35 15.2%
Met (M) 3 1.3%
Phe (F) 6 2.6%
Pro (P) 6 2.6%
Ser (S) 10 4.3%
Thr (T) 7 3.0%
Trp (W) 1 0.4%
Tyr (Y) 9 3.9%
Val (V) 8 3.5%
Asx (B) 0 0.0%
Glx (Z) 0 0.0%
Xaa (X) 0 0.0%
Total number of negatively charged residues (Asp + Glu): 41
Total number of positively charged residues (Arg + Lys): 44
Atomic composition:
Carbon C 1192
Hydrogen H 1949
Nitrogen N 313
Oxygen O 353
Sulfur S 6
Formula: C1192H1949N313O353S6
Total number of atoms: 3813
Extinction coefficients:
Conditions: 6.0 M guanidium hydrochloride
0.02 M phosphate buffer
pH 6.5
Extinction coefficients are in units of M-1 cm-1 .
The first table lists values computed assuming ALL Cys
residues appear as half cystines, whereas the second table
assumes that NONE do.
276 278 279 280 282
nm nm nm nm nm
Ext. coefficient 18595 18327 17885 17330 16520
Abs 0.1% (=1 g/l) 0.702 0.691 0.675 0.654 0.623
276 278 279 280 282
nm nm nm nm nm
Ext. coefficient 18450 18200 17765 17210 16400
Abs 0.1% (=1 g/l) 0.696 0.687 0.670 0.649 0.619
Estimated half-life:
The N-terminal of the sequence considered is M (Met).
The estimated half-life is: 30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Instability index:
The instability index (II) is computed to be 43.31
This classifies the protein as unstable.
Aliphatic index: 101.83
Grand average of hydropathicity (GRAVY): -0.491