Berkeley Structural Genomics Center

Target info for 1150B

This target is MP487 / MPN349, gi number 1674178 from Mycoplasma pneumoniae.

This gene has the annotation "MG246 homolog, from M. genitalium".

The target was selected as part of JMC's first set.

Available sections:


Experimental status of 1150B

Note: Dates prior to 10/24/01 may be inaccurate, due to conversion from a record-keeping system which tracked only the last experimental date, to a new system which keeps track of all dates. The user is the person who entered the data, not the person who did the experiment. This will also change in the future.

ExperimentResultUserExperiment Date
SelectedDonejmc2001-08-28
ClonedDoneblgold2002-08-28
Expression testedDonedhshin2003-05-28
Solubility testedSdhshin2003-05-28
PurifiedDonedhshin2003-05-28
CrystallizedDonedhshin2003-05-28
Diffraction quality crystalsDonedhshin2003-06-18
Native diffraction dataDonedhshin2003-06-18
Phasing diffraction dataDonedhshin2004-05-07
Traceable mapDonedhshin2003-06-18
Crystal structureDonedhshin2003-06-18
In PDB1T71dhshin2004-05-07
Suggested work stop18217 18217dallen2003-03-24

Back to Top


Potential MP Homologues of 1150B

MP genelog10(PSIBLAST E)% identical% coverage (of MP gene)
MP487 / MPN349-116.00100.00100.00

Back to Top


1150B DNA sequence

ATGATGAATAGCATTAAATTCATTTTCCTAGGTGACGTCTATGGCAAGGCCGGACGTAATATTATTAAGAATAATCTAGC
CCAACTCAAATCAAAGTATCAAGCTGATTTAGTCATTGTTAATGCCGAAAATACGACTCACGGTAAAGGACTTAGTTTAA
AGCACTATGAGTTTCTAAAAGAGGCAGGCGTTAATTACATTACTATGGGTAATCATACCTGGTTTCAGAAGCTAGATTTA
GCTGTTGTAATTAATAAAAAGGACTTAGTGCGTCCTTTAAATTTAGACACCAGTTTTGCTTTTCATAACTTAGGGCAAGG
TAGTCTTGTATTTGAGTTTAATAAAGCAAAGATTAGGATAACTAATTTACTGGGTACTAGTGTGCCCTTACCCTTTAAAA
CAACTAATCCCTTTAAAGTTTTAAAAGAACTAATTTTAAAGCGCGATTGTGATCTTCATATAGTTGATTTTCACGCTGAA
ACCACCAGTGAAAAAAACGCCTTTTGCATGGCTTTTGATGGTTATGTCACAACCATTTTCGGCACCCACACCCACGTGCC
TAGTGCTGATTTAAGAATCACCCCCAAAGGTAGTGCTTACATTACCGATGTCGGGATGTGTGGTCCGGGATTTGGTAGTG
TTATTGGTGCTAACCCCGAACAGTCGATCAGACTCTTTTGTGCTGGTAGCAGAGAACACTTTGAGGTATCTAAATGCGGA
GCACAACTCAATGGTGTCTTCTTTGAGGTTGATGTAAATACAAAAAAGGTGATTAAAACAGAGGCGATTAGGATTGTGGA
GGACGATCCTAGATACTTAAAACAAGACTACTTTAACCTAATTTAA

Back to Top


1150B Codon Usage

(282 codons)
fields: [triplet] [frequency: per thousand] ([number])

UUU56.7(  16)  UCU3.5(   1)  UAU14.2(   4)  UGU10.6(   3)  
UUC14.2(   4)  UCC0.0(   0)  UAC14.2(   4)  UGC7.1(   2)  
UUA46.1(  13)  UCA3.5(   1)  UAA3.5(   1)  UGA0.0(   0)  
UUG0.0(   0)  UCG3.5(   1)  UAG0.0(   0)  UGG3.5(   1)  

CUU10.6(   3)  CCU10.6(   3)  CAU10.6(   3)  CGU7.1(   2)  
CUC10.6(   3)  CCC17.7(   5)  CAC21.3(   6)  CGC3.5(   1)  
CUA21.3(   6)  CCA0.0(   0)  CAA17.7(   5)  CGA0.0(   0)  
CUG3.5(   1)  CCG3.5(   1)  CAG7.1(   2)  CGG0.0(   0)  

AUU56.7(  16)  ACU17.7(   5)  AAU53.2(  15)  AGU28.4(   8)  
AUC7.1(   2)  ACC31.9(   9)  AAC14.2(   4)  AGC7.1(   2)  
AUA7.1(   2)  ACA14.2(   4)  AAA53.2(  15)  AGA14.2(   4)  
AUG17.7(   5)  ACG3.5(   1)  AAG31.9(   9)  AGG7.1(   2)  

GUU24.8(   7)  GCU31.9(   9)  GAU35.5(  10)  GGU42.6(  12)  
GUC17.7(   5)  GCC14.2(   4)  GAC17.7(   5)  GGC10.6(   3)  
GUA14.2(   4)  GCA10.6(   3)  GAA21.3(   6)  GGA14.2(   4)  
GUG17.7(   5)  GCG3.5(   1)  GAG24.8(   7)  GGG7.1(   2)  

Back to Top


1150B Potential Cloning Problems

No UGA codons or (bad) restriction sites!

Back to Top


1150B Automatically Selected Primers

Note: These were generated using Hisao's algorithm, and do not take into account possible mispriming, self-complementarity, or requirements for mutations anywhere in the sequences. The -R1 primers are for the N-terminal end, and begin with an NdeI restriction site (CATATG). The -R2 primers are for the C-terminal end, and begin with a BamHI site (GGATCC) if the target has no other BamHI sites. If the target does have a BamHI site, the -R2 primer wil begin with a BglII site (AGATCT), unless the target has no BglII sites. If the target has both sites, the design program gives up and doesn't prepend a restriction site to the -R2 primer!

Predicted Tm was obtained using the Tm determination tool at the Virtual Genome Center.

Primer IDPredicted Tmsequence
1150B-R160.80CATATGATGAATAGCATTAAATTCATTTTCC
1150B-R261.70GGATCCTTAAATTAGGTTAAAGTAGTCTTGTTTTAAGTATCTAGG
1150B-R1064.30GGCGGTGGTGGCGGCATGATGAATAGCATTAAATTCATTTTCCTAGG
1150B-R1163.00GTTCTTCTCCTTTGCGCCCCTAAATTAGGTTAAAGTAGTCTTGTTTTAAGTATCTAGGATC

Back to Top


1150B Translation

Note: This was generated using the standard codon usage table; UGA codons in MP/MP genes will show up as terminators ("*")

atgatgaatagcattaaattcattttcctaggtgacgtctatggcaaggccggacgtaat
 M  M  N  S  I  K  F  I  F  L  G  D  V  Y  G  K  A  G  R  N 
attattaagaataatctagcccaactcaaatcaaagtatcaagctgatttagtcattgtt
 I  I  K  N  N  L  A  Q  L  K  S  K  Y  Q  A  D  L  V  I  V 
aatgccgaaaatacgactcacggtaaaggacttagtttaaagcactatgagtttctaaaa
 N  A  E  N  T  T  H  G  K  G  L  S  L  K  H  Y  E  F  L  K 
gaggcaggcgttaattacattactatgggtaatcatacctggtttcagaagctagattta
 E  A  G  V  N  Y  I  T  M  G  N  H  T  W  F  Q  K  L  D  L 
gctgttgtaattaataaaaaggacttagtgcgtcctttaaatttagacaccagttttgct
 A  V  V  I  N  K  K  D  L  V  R  P  L  N  L  D  T  S  F  A 
tttcataacttagggcaaggtagtcttgtatttgagtttaataaagcaaagattaggata
 F  H  N  L  G  Q  G  S  L  V  F  E  F  N  K  A  K  I  R  I 
actaatttactgggtactagtgtgcccttaccctttaaaacaactaatccctttaaagtt
 T  N  L  L  G  T  S  V  P  L  P  F  K  T  T  N  P  F  K  V 
ttaaaagaactaattttaaagcgcgattgtgatcttcatatagttgattttcacgctgaa
 L  K  E  L  I  L  K  R  D  C  D  L  H  I  V  D  F  H  A  E 
accaccagtgaaaaaaacgccttttgcatggcttttgatggttatgtcacaaccattttc
 T  T  S  E  K  N  A  F  C  M  A  F  D  G  Y  V  T  T  I  F 
ggcacccacacccacgtgcctagtgctgatttaagaatcacccccaaaggtagtgcttac
 G  T  H  T  H  V  P  S  A  D  L  R  I  T  P  K  G  S  A  Y 
attaccgatgtcgggatgtgtggtccgggatttggtagtgttattggtgctaaccccgaa
 I  T  D  V  G  M  C  G  P  G  F  G  S  V  I  G  A  N  P  E 
cagtcgatcagactcttttgtgctggtagcagagaacactttgaggtatctaaatgcgga
 Q  S  I  R  L  F  C  A  G  S  R  E  H  F  E  V  S  K  C  G 
gcacaactcaatggtgtcttctttgaggttgatgtaaatacaaaaaaggtgattaaaaca
 A  Q  L  N  G  V  F  F  E  V  D  V  N  T  K  K  V  I  K  T 
gaggcgattaggattgtggaggacgatcctagatacttaaaacaagactactttaaccta
 E  A  I  R  I  V  E  D  D  P  R  Y  L  K  Q  D  Y  F  N  L 
atttaa
 I  * 

Back to Top


1150B AA Sequence

MMNSIKFIFLGDVYGKAGRNIIKNNLAQLKSKYQADLVIVNAENTTHGKGLSLKHYEFLKEAGVNYITMGNHTWFQKLDL
AVVINKKDLVRPLNLDTSFAFHNLGQGSLVFEFNKAKIRITNLLGTSVPLPFKTTNPFKVLKELILKRDCDLHIVDFHAE
TTSEKNAFCMAFDGYVTTIFGTHTHVPSADLRITPKGSAYITDVGMCGPGFGSVIGANPEQSIRLFCAGSREHFEVSKCG
AQLNGVFFEVDVNTKKVIKTEAIRIVEDDPRYLKQDYFNLI

Back to Top


1150B Protein Parameters

This information was obtained using the Protein Parameters tool on the ExPASy Molecular Biology Server.

Number of amino acids: 281

Molecular weight: 31431.2

Theoretical pI: 8.83

Amino acid composition:

Ala (A)  17	  6.0%
Arg (R)   9	  3.2%
Asn (N)  19	  6.8%
Asp (D)  15	  5.3%
Cys (C)   5	  1.8%
Gln (Q)   7	  2.5%
Glu (E)  13	  4.6%
Gly (G)  21	  7.5%
His (H)   9	  3.2%
Ile (I)  20	  7.1%
Leu (L)  26	  9.3%
Lys (K)  24	  8.5%
Met (M)   5	  1.8%
Phe (F)  20	  7.1%
Pro (P)   9	  3.2%
Ser (S)  13	  4.6%
Thr (T)  19	  6.8%
Trp (W)   1	  0.4%
Tyr (Y)   8	  2.8%
Val (V)  21	  7.5%

Asx (B)   0	  0.0%
Glx (Z)   0	  0.0%
Xaa (X)   0	  0.0%

Total number of negatively charged residues (Asp + Glu): 28
Total number of positively charged residues (Arg + Lys): 33

Atomic composition:

Carbon      C	      1425
Hydrogen    H	      2233
Nitrogen    N	       377
Oxygen      O	       404
Sulfur      S	        10

Formula: C1425H2233N377O404S10
Total number of atoms: 4449

Extinction coefficients:

Conditions: 6.0 M guanidium hydrochloride
            0.02 M phosphate buffer
            pH 6.5

Extinction coefficients are in units of  M-1 cm-1 .

The first table lists values computed assuming ALL Cys 
residues appear as half cystines, whereas the second table 
assumes that NONE do. 

                      276     278     279     280     282
                       nm      nm      nm      nm      nm
Ext. coefficient    17290   17054   16660   16170   15440
Abs 0.1% (=1 g/l)   0.550   0.543   0.530   0.514   0.491



                      276     278     279     280     282
                       nm      nm      nm      nm      nm
Ext. coefficient    17000   16800   16420   15930   15200
Abs 0.1% (=1 g/l)   0.541   0.535   0.522   0.507   0.484


Estimated half-life:

The N-terminal of the sequence considered is M (Met).

The estimated half-life is: 30 hours (mammalian reticulocytes, in vitro).
                            >20 hours (yeast, in vivo).
                            >10 hours (Escherichia coli, in vivo).


Instability index:

The instability index (II) is computed to be 16.84
This classifies the protein as stable.



Aliphatic index: 91.57

Grand average of hydropathicity (GRAVY): -0.086

Back to Top