Berkeley Structural Genomics Center

Target info for 1167B

This target is gi number 4982022 from Thermotoga maritima.

This gene has the annotation "hypothetical protein".

The target was selected as part of JMC's first set.

Available sections:


Experimental status of 1167B

Note: Dates prior to 10/24/01 may be inaccurate, due to conversion from a record-keeping system which tracked only the last experimental date, to a new system which keeps track of all dates. The user is the person who entered the data, not the person who did the experiment. This will also change in the future.

ExperimentResultUserExperiment Date
SelectedDonejmc2001-08-28
ClonedDoner_kim2002-01-15
Expression testedDoner_kim2002-01-15
Solubility testedSr_kim2002-01-15
PurifiedDoner_kim2002-02-26
CrystallizedDonedhshin2002-08-27
Diffraction quality crystalsDonedhshin2002-08-27
Native diffraction dataDonedhshin2002-08-27
Phasing diffraction dataDonedhshin2002-08-27
Traceable mapDonedhshin2002-08-27
Crystal structureDonedhshin2002-08-27
NMR characterizationDonedewemmer2002-10-11
HSQCDonedewemmer2002-10-11
In PDB1S12dhshin2004-01-05
Suggested work stop19183 19183dallen2003-05-20
Override suggest work stopStructure solveddhshin2003-06-05

Back to Top


Potential MP Homologues of 1167B

No MP homologues identified for this gene.

Back to Top


1167B DNA sequence

ATGATAAAAGTAACTGTGACTAATTCTTTTTTTGAAGTAACGGGTCATGCACCAGACAAAACACTGTGCGCTTCAGTTAG
TCTTTTGACGCAGCATGTGGCGAACTTTCTGAAAGCCGAGAAAAAAGCGAAAATAAAGAAGGAATCCGGTTATCTGAAAG
TGAAATTTGAAGAACTCGAAAACTGCGAAGTGAAGGTGCTAGCGGCTATGGTGAGGTCTTTGAAAGAACTCGAACAGAAG
TTTCCTTCTCAGATCAGAGTGGAGGTGATCGACAATGGCTCATAA

Back to Top


1167B Codon Usage

(95 codons)
fields: [triplet] [frequency: per thousand] ([number])

UUU52.6(   5)  UCU31.6(   3)  UAU10.5(   1)  UGU0.0(   0)  
UUC0.0(   0)  UCC10.5(   1)  UAC0.0(   0)  UGC21.1(   2)  
UUA0.0(   0)  UCA21.1(   2)  UAA10.5(   1)  UGA0.0(   0)  
UUG21.1(   2)  UCG0.0(   0)  UAG0.0(   0)  UGG0.0(   0)  

CUU10.5(   1)  CCU10.5(   1)  CAU21.1(   2)  CGU0.0(   0)  
CUC21.1(   2)  CCC0.0(   0)  CAC0.0(   0)  CGC0.0(   0)  
CUA10.5(   1)  CCA10.5(   1)  CAA0.0(   0)  CGA0.0(   0)  
CUG31.6(   3)  CCG0.0(   0)  CAG31.6(   3)  CGG0.0(   0)  

AUU0.0(   0)  ACU21.1(   2)  AAU21.1(   2)  AGU10.5(   1)  
AUC21.1(   2)  ACC0.0(   0)  AAC21.1(   2)  AGC0.0(   0)  
AUA21.1(   2)  ACA10.5(   1)  AAA94.7(   9)  AGA10.5(   1)  
AUG21.1(   2)  ACG21.1(   2)  AAG42.1(   4)  AGG10.5(   1)  

GUU10.5(   1)  GCU21.1(   2)  GAU0.0(   0)  GGU21.1(   2)  
GUC0.0(   0)  GCC10.5(   1)  GAC21.1(   2)  GGC10.5(   1)  
GUA21.1(   2)  GCA10.5(   1)  GAA84.2(   8)  GGA0.0(   0)  
GUG84.2(   8)  GCG31.6(   3)  GAG21.1(   2)  GGG0.0(   0)  

Back to Top


1167B Potential Cloning Problems

No UGA codons or (bad) restriction sites!

Back to Top


1167B Automatically Selected Primers

Note: These were generated using Hisao's algorithm, and do not take into account possible mispriming, self-complementarity, or requirements for mutations anywhere in the sequences. The -R1 primers are for the N-terminal end, and begin with an NdeI restriction site (CATATG). The -R2 primers are for the C-terminal end, and begin with a BamHI site (GGATCC) if the target has no other BamHI sites. If the target does have a BamHI site, the -R2 primer wil begin with a BglII site (AGATCT), unless the target has no BglII sites. If the target has both sites, the design program gives up and doesn't prepend a restriction site to the -R2 primer!

Predicted Tm was obtained using the Tm determination tool at the Virtual Genome Center.

Primer IDPredicted Tmsequence
1167B-R161.70CATATGATAAAAGTAACTGTGACTAATTCTTTTTTTG
1167B-R262.00GGATCCTTATGAGCCATTGTCGATCACC
1167B-R1063.50GGCGGTGGTGGCGGCATGATAAAAGTAACTGTGACTAATTCTTTTTTTGAA
1167B-R1163.40GTTCTTCTCCTTTGCGCCCCTATGAGCCATTGTCGATCACCTC

Back to Top


1167B Translation

Note: This was generated using the standard codon usage table; UGA codons in MP/MP genes will show up as terminators ("*")

atgataaaagtaactgtgactaattctttttttgaagtaacgggtcatgcaccagacaaa
 M  I  K  V  T  V  T  N  S  F  F  E  V  T  G  H  A  P  D  K 
acactgtgcgcttcagttagtcttttgacgcagcatgtggcgaactttctgaaagccgag
 T  L  C  A  S  V  S  L  L  T  Q  H  V  A  N  F  L  K  A  E 
aaaaaagcgaaaataaagaaggaatccggttatctgaaagtgaaatttgaagaactcgaa
 K  K  A  K  I  K  K  E  S  G  Y  L  K  V  K  F  E  E  L  E 
aactgcgaagtgaaggtgctagcggctatggtgaggtctttgaaagaactcgaacagaag
 N  C  E  V  K  V  L  A  A  M  V  R  S  L  K  E  L  E  Q  K 
tttccttctcagatcagagtggaggtgatcgacaatggctcataa
 F  P  S  Q  I  R  V  E  V  I  D  N  G  S  * 

Back to Top


1167B AA Sequence

MIKVTVTNSFFEVTGHAPDKTLCASVSLLTQHVANFLKAEKKAKIKKESGYLKVKFEELENCEVKVLAAMVRSLKELEQK
FPSQIRVEVIDNGS

Back to Top


1167B Protein Parameters

This information was obtained using the Protein Parameters tool on the ExPASy Molecular Biology Server.

Number of amino acids: 94

Molecular weight: 10540.3

Theoretical pI: 8.93

Amino acid composition:

Ala (A)   7	  7.4%
Arg (R)   2	  2.1%
Asn (N)   4	  4.3%
Asp (D)   2	  2.1%
Cys (C)   2	  2.1%
Gln (Q)   3	  3.2%
Glu (E)  10	 10.6%
Gly (G)   3	  3.2%
His (H)   2	  2.1%
Ile (I)   4	  4.3%
Leu (L)   9	  9.6%
Lys (K)  13	 13.8%
Met (M)   2	  2.1%
Phe (F)   5	  5.3%
Pro (P)   2	  2.1%
Ser (S)   7	  7.4%
Thr (T)   5	  5.3%
Trp (W)   0	  0.0%
Tyr (Y)   1	  1.1%
Val (V)  11	 11.7%

Asx (B)   0	  0.0%
Glx (Z)   0	  0.0%
Xaa (X)   0	  0.0%

Total number of negatively charged residues (Asp + Glu): 12
Total number of positively charged residues (Arg + Lys): 15

Atomic composition:

Carbon      C	       472
Hydrogen    H	       776
Nitrogen    N	       124
Oxygen      O	       139
Sulfur      S	         4

Formula: C472H776N124O139S4
Total number of atoms: 1515

Extinction coefficients:

Conditions: 6.0 M guanidium hydrochloride
            0.02 M phosphate buffer
            pH 6.5

Extinction coefficients are in units of  M-1 cm-1 .

The first table lists values computed assuming ALL Cys 
residues appear as half cystines, whereas the second table 
assumes that NONE do. 

                      276     278     279     280     282
                       nm      nm      nm      nm      nm
Ext. coefficient     1595    1527    1465    1400    1320
Abs 0.1% (=1 g/l)   0.151   0.145   0.139   0.133   0.125



                      276     278     279     280     282
                       nm      nm      nm      nm      nm
Ext. coefficient     1450    1400    1345    1280    1200
Abs 0.1% (=1 g/l)   0.138   0.133   0.128   0.121   0.114


Estimated half-life:

The N-terminal of the sequence considered is M (Met).

The estimated half-life is: 30 hours (mammalian reticulocytes, in vitro).
                            >20 hours (yeast, in vivo).
                            >10 hours (Escherichia coli, in vivo).


Instability index:

The instability index (II) is computed to be 9.46
This classifies the protein as stable.



Aliphatic index: 95.32

Grand average of hydropathicity (GRAVY): -0.145

Back to Top