|
|
This gene has the annotation "small heat shock protein (hsp20)".
The target was selected as part of pre-BSGC set.
Available sections:
| Experiment | Result | User | Experiment Date |
|---|---|---|---|
| Selected | Done | jmc | 2001-09-10 |
| Cloned | Done | abwaight | 2001-09-10 |
| Expression tested | Done | abwaight | 2001-09-10 |
| Solubility tested | S | abwaight | 2001-09-10 |
| Purified | Done | abwaight | 2001-09-10 |
| Crystallized | Done | abwaight | 2001-09-10 |
| Diffraction quality crystals | Done | abwaight | 2001-09-10 |
| Phasing diffraction data | Done | abwaight | 2001-09-10 |
| Traceable map | Done | abwaight | 2001-09-10 |
| Crystal structure | Done | abwaight | 2001-09-10 |
| In PDB | 1SHS | abwaight | 2001-09-10 |
| Biochemical function | Done | dhshin | 2001-09-09 |
ATGTTCGGAAGAGACCCATTTGATTCATTATTTGAAAGAATGTTTAAAGAGTTTTTTGCAACACCAATGACAGGAACCAC AATGATTCAAAGCTCAACAGGAATACAAATTTCTGGAAAAGGGTTCATGCCAATCTCAATTATTGAAGGAGACCAGCATA TAAAAGTTATTGCATGGTTGCCAGGGGTTAATAAAGAGGACATAATTTTAAATGCAGTTGGAGATACATTAGAGATTAGA GCTAAGAGAAGCCCATTAATGATAACTGAGAGTGAAAGAATTATCTACTCAGAAATTCCAGAAGAGGAAGAAATATATAG AACAATAAAACTTCCTGCAACTGTTAAGGAAGAAAATGCCTCAGCTAAGTTTGAAAATGGTGTTTTATCAGTTATATTAC CAAAGGCAGAATCCTCAATTAAGAAAGGAATCAACATTGAATAA
(148 codons) fields: [triplet] [frequency: per thousand] ([number]) UUU40.5( 6) UCU6.8( 1) UAU6.8( 1) UGU0.0( 0) UUC13.5( 2) UCC6.8( 1) UAC6.8( 1) UGC0.0( 0) UUA40.5( 6) UCA47.3( 7) UAA6.8( 1) UGA0.0( 0) UUG6.8( 1) UCG0.0( 0) UAG0.0( 0) UGG6.8( 1) CUU6.8( 1) CCU6.8( 1) CAU6.8( 1) CGU0.0( 0) CUC0.0( 0) CCC0.0( 0) CAC0.0( 0) CGC0.0( 0) CUA0.0( 0) CCA47.3( 7) CAA13.5( 2) CGA0.0( 0) CUG0.0( 0) CCG0.0( 0) CAG6.8( 1) CGG0.0( 0) AUU74.3( 11) ACU13.5( 2) AAU27.0( 4) AGU6.8( 1) AUC20.3( 3) ACC6.8( 1) AAC6.8( 1) AGC13.5( 2) AUA47.3( 7) ACA40.5( 6) AAA40.5( 6) AGA40.5( 6) AUG40.5( 6) ACG0.0( 0) AAG33.8( 5) AGG0.0( 0) GUU40.5( 6) GCU13.5( 2) GAU13.5( 2) GGU6.8( 1) GUC0.0( 0) GCC6.8( 1) GAC20.3( 3) GGC0.0( 0) GUA0.0( 0) GCA33.8( 5) GAA81.1( 12) GGA47.3( 7) GUG0.0( 0) GCG0.0( 0) GAG33.8( 5) GGG13.5( 2)
Note: These were generated using Hisao's algorithm, and do not take into account possible mispriming, self-complementarity, or requirements for mutations anywhere in the sequences. The -R1 primers are for the N-terminal end, and begin with an NdeI restriction site (CATATG). The -R2 primers are for the C-terminal end, and begin with a BamHI site (GGATCC) if the target has no other BamHI sites. If the target does have a BamHI site, the -R2 primer wil begin with a BglII site (AGATCT), unless the target has no BglII sites. If the target has both sites, the design program gives up and doesn't prepend a restriction site to the -R2 primer!
Predicted Tm was obtained using the Tm determination tool at the Virtual Genome Center.
| Primer ID | Predicted Tm | sequence |
|---|---|---|
| 1195B-R1 | 62.30 | CATATGTTCGGAAGAGACCCATTTG |
| 1195B-R2 | 60.90 | GGATCCTTATTCAATGTTGATTCCTTTCTTAATTG |
| 1195B-R10 | 64.00 | GGCGGTGGTGGCGGCATGTTCGGAAGAGACCCATTTGA |
| 1195B-R11 | 64.40 | GTTCTTCTCCTTTGCGCCCCTATTCAATGTTGATTCCTTTCTTAATTGAGG |
Note: This was generated using the standard codon usage table; UGA codons in MP/MP genes will show up as terminators ("*")
atgttcggaagagacccatttgattcattatttgaaagaatgtttaaagagttttttgca M F G R D P F D S L F E R M F K E F F A acaccaatgacaggaaccacaatgattcaaagctcaacaggaatacaaatttctggaaaa T P M T G T T M I Q S S T G I Q I S G K gggttcatgccaatctcaattattgaaggagaccagcatataaaagttattgcatggttg G F M P I S I I E G D Q H I K V I A W L ccaggggttaataaagaggacataattttaaatgcagttggagatacattagagattaga P G V N K E D I I L N A V G D T L E I R gctaagagaagcccattaatgataactgagagtgaaagaattatctactcagaaattcca A K R S P L M I T E S E R I I Y S E I P gaagaggaagaaatatatagaacaataaaacttcctgcaactgttaaggaagaaaatgcc E E E E I Y R T I K L P A T V K E E N A tcagctaagtttgaaaatggtgttttatcagttatattaccaaaggcagaatcctcaatt S A K F E N G V L S V I L P K A E S S I aagaaaggaatcaacattgaataa K K G I N I E *
MFGRDPFDSLFERMFKEFFATPMTGTTMIQSSTGIQISGKGFMPISIIEGDQHIKVIAWLPGVNKEDIILNAVGDTLEIR AKRSPLMITESERIIYSEIPEEEEIYRTIKLPATVKEENASAKFENGVLSVILPKAESSIKKGINIE
This information was obtained using the Protein Parameters tool on the ExPASy Molecular Biology Server.
Number of amino acids: 147
Molecular weight: 16452.0
Theoretical pI: 5.06
Amino acid composition:
Ala (A) 8 5.4%
Arg (R) 6 4.1%
Asn (N) 5 3.4%
Asp (D) 5 3.4%
Cys (C) 0 0.0%
Gln (Q) 3 2.0%
Glu (E) 17 11.6%
Gly (G) 10 6.8%
His (H) 1 0.7%
Ile (I) 21 14.3%
Leu (L) 8 5.4%
Lys (K) 11 7.5%
Met (M) 6 4.1%
Phe (F) 8 5.4%
Pro (P) 8 5.4%
Ser (S) 12 8.2%
Thr (T) 9 6.1%
Trp (W) 1 0.7%
Tyr (Y) 2 1.4%
Val (V) 6 4.1%
Asx (B) 0 0.0%
Glx (Z) 0 0.0%
Xaa (X) 0 0.0%
Total number of negatively charged residues (Asp + Glu): 22
Total number of positively charged residues (Arg + Lys): 17
Atomic composition:
Carbon C 739
Hydrogen H 1187
Nitrogen N 187
Oxygen O 223
Sulfur S 6
Formula: C739H1187N187O223S6
Total number of atoms: 2342
Extinction coefficients:
Conditions: 6.0 M guanidium hydrochloride
0.02 M phosphate buffer
pH 6.5
Extinction coefficients are in units of M-1 cm-1 .
276 278 279 280 282
nm nm nm nm nm
Ext. coefficient 8300 8400 8350 8250 8000
Abs 0.1% (=1 g/l) 0.504 0.511 0.508 0.501 0.486
Estimated half-life:
The N-terminal of the sequence considered is M (Met).
The estimated half-life is: 30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Instability index:
The instability index (II) is computed to be 60.90
This classifies the protein as unstable.
Aliphatic index: 94.22
Grand average of hydropathicity (GRAVY): -0.109