Berkeley Structural Genomics Center

Target info for 1195B

This target is gi number 1591008 from Methanococcus jannaschii.

This gene has the annotation "small heat shock protein (hsp20)".

The target was selected as part of pre-BSGC set.

Available sections:


Experimental status of 1195B

Note: Dates prior to 10/24/01 may be inaccurate, due to conversion from a record-keeping system which tracked only the last experimental date, to a new system which keeps track of all dates. The user is the person who entered the data, not the person who did the experiment. This will also change in the future.

ExperimentResultUserExperiment Date
SelectedDonejmc2001-09-10
ClonedDoneabwaight2001-09-10
Expression testedDoneabwaight2001-09-10
Solubility testedSabwaight2001-09-10
PurifiedDoneabwaight2001-09-10
CrystallizedDoneabwaight2001-09-10
Diffraction quality crystalsDoneabwaight2001-09-10
Phasing diffraction dataDoneabwaight2001-09-10
Traceable mapDoneabwaight2001-09-10
Crystal structureDoneabwaight2001-09-10
In PDB1SHSabwaight2001-09-10
Biochemical functionDonedhshin2001-09-09

Back to Top


Potential MP Homologues of 1195B

No MP homologues identified for this gene.

Back to Top


1195B DNA sequence

ATGTTCGGAAGAGACCCATTTGATTCATTATTTGAAAGAATGTTTAAAGAGTTTTTTGCAACACCAATGACAGGAACCAC
AATGATTCAAAGCTCAACAGGAATACAAATTTCTGGAAAAGGGTTCATGCCAATCTCAATTATTGAAGGAGACCAGCATA
TAAAAGTTATTGCATGGTTGCCAGGGGTTAATAAAGAGGACATAATTTTAAATGCAGTTGGAGATACATTAGAGATTAGA
GCTAAGAGAAGCCCATTAATGATAACTGAGAGTGAAAGAATTATCTACTCAGAAATTCCAGAAGAGGAAGAAATATATAG
AACAATAAAACTTCCTGCAACTGTTAAGGAAGAAAATGCCTCAGCTAAGTTTGAAAATGGTGTTTTATCAGTTATATTAC
CAAAGGCAGAATCCTCAATTAAGAAAGGAATCAACATTGAATAA

Back to Top


1195B Codon Usage

(148 codons)
fields: [triplet] [frequency: per thousand] ([number])

UUU40.5(   6)  UCU6.8(   1)  UAU6.8(   1)  UGU0.0(   0)  
UUC13.5(   2)  UCC6.8(   1)  UAC6.8(   1)  UGC0.0(   0)  
UUA40.5(   6)  UCA47.3(   7)  UAA6.8(   1)  UGA0.0(   0)  
UUG6.8(   1)  UCG0.0(   0)  UAG0.0(   0)  UGG6.8(   1)  

CUU6.8(   1)  CCU6.8(   1)  CAU6.8(   1)  CGU0.0(   0)  
CUC0.0(   0)  CCC0.0(   0)  CAC0.0(   0)  CGC0.0(   0)  
CUA0.0(   0)  CCA47.3(   7)  CAA13.5(   2)  CGA0.0(   0)  
CUG0.0(   0)  CCG0.0(   0)  CAG6.8(   1)  CGG0.0(   0)  

AUU74.3(  11)  ACU13.5(   2)  AAU27.0(   4)  AGU6.8(   1)  
AUC20.3(   3)  ACC6.8(   1)  AAC6.8(   1)  AGC13.5(   2)  
AUA47.3(   7)  ACA40.5(   6)  AAA40.5(   6)  AGA40.5(   6)  
AUG40.5(   6)  ACG0.0(   0)  AAG33.8(   5)  AGG0.0(   0)  

GUU40.5(   6)  GCU13.5(   2)  GAU13.5(   2)  GGU6.8(   1)  
GUC0.0(   0)  GCC6.8(   1)  GAC20.3(   3)  GGC0.0(   0)  
GUA0.0(   0)  GCA33.8(   5)  GAA81.1(  12)  GGA47.3(   7)  
GUG0.0(   0)  GCG0.0(   0)  GAG33.8(   5)  GGG13.5(   2)  

Back to Top


1195B Potential Cloning Problems

No UGA codons or (bad) restriction sites!

Back to Top


1195B Automatically Selected Primers

Note: These were generated using Hisao's algorithm, and do not take into account possible mispriming, self-complementarity, or requirements for mutations anywhere in the sequences. The -R1 primers are for the N-terminal end, and begin with an NdeI restriction site (CATATG). The -R2 primers are for the C-terminal end, and begin with a BamHI site (GGATCC) if the target has no other BamHI sites. If the target does have a BamHI site, the -R2 primer wil begin with a BglII site (AGATCT), unless the target has no BglII sites. If the target has both sites, the design program gives up and doesn't prepend a restriction site to the -R2 primer!

Predicted Tm was obtained using the Tm determination tool at the Virtual Genome Center.

Primer IDPredicted Tmsequence
1195B-R162.30CATATGTTCGGAAGAGACCCATTTG
1195B-R260.90GGATCCTTATTCAATGTTGATTCCTTTCTTAATTG
1195B-R1064.00GGCGGTGGTGGCGGCATGTTCGGAAGAGACCCATTTGA
1195B-R1164.40GTTCTTCTCCTTTGCGCCCCTATTCAATGTTGATTCCTTTCTTAATTGAGG

Back to Top


1195B Translation

Note: This was generated using the standard codon usage table; UGA codons in MP/MP genes will show up as terminators ("*")

atgttcggaagagacccatttgattcattatttgaaagaatgtttaaagagttttttgca
 M  F  G  R  D  P  F  D  S  L  F  E  R  M  F  K  E  F  F  A 
acaccaatgacaggaaccacaatgattcaaagctcaacaggaatacaaatttctggaaaa
 T  P  M  T  G  T  T  M  I  Q  S  S  T  G  I  Q  I  S  G  K 
gggttcatgccaatctcaattattgaaggagaccagcatataaaagttattgcatggttg
 G  F  M  P  I  S  I  I  E  G  D  Q  H  I  K  V  I  A  W  L 
ccaggggttaataaagaggacataattttaaatgcagttggagatacattagagattaga
 P  G  V  N  K  E  D  I  I  L  N  A  V  G  D  T  L  E  I  R 
gctaagagaagcccattaatgataactgagagtgaaagaattatctactcagaaattcca
 A  K  R  S  P  L  M  I  T  E  S  E  R  I  I  Y  S  E  I  P 
gaagaggaagaaatatatagaacaataaaacttcctgcaactgttaaggaagaaaatgcc
 E  E  E  E  I  Y  R  T  I  K  L  P  A  T  V  K  E  E  N  A 
tcagctaagtttgaaaatggtgttttatcagttatattaccaaaggcagaatcctcaatt
 S  A  K  F  E  N  G  V  L  S  V  I  L  P  K  A  E  S  S  I 
aagaaaggaatcaacattgaataa
 K  K  G  I  N  I  E  * 

Back to Top


1195B AA Sequence

MFGRDPFDSLFERMFKEFFATPMTGTTMIQSSTGIQISGKGFMPISIIEGDQHIKVIAWLPGVNKEDIILNAVGDTLEIR
AKRSPLMITESERIIYSEIPEEEEIYRTIKLPATVKEENASAKFENGVLSVILPKAESSIKKGINIE

Back to Top


1195B Protein Parameters

This information was obtained using the Protein Parameters tool on the ExPASy Molecular Biology Server.

Number of amino acids: 147

Molecular weight: 16452.0

Theoretical pI: 5.06

Amino acid composition:

Ala (A)   8	  5.4%
Arg (R)   6	  4.1%
Asn (N)   5	  3.4%
Asp (D)   5	  3.4%
Cys (C)   0	  0.0%
Gln (Q)   3	  2.0%
Glu (E)  17	 11.6%
Gly (G)  10	  6.8%
His (H)   1	  0.7%
Ile (I)  21	 14.3%
Leu (L)   8	  5.4%
Lys (K)  11	  7.5%
Met (M)   6	  4.1%
Phe (F)   8	  5.4%
Pro (P)   8	  5.4%
Ser (S)  12	  8.2%
Thr (T)   9	  6.1%
Trp (W)   1	  0.7%
Tyr (Y)   2	  1.4%
Val (V)   6	  4.1%

Asx (B)   0	  0.0%
Glx (Z)   0	  0.0%
Xaa (X)   0	  0.0%

Total number of negatively charged residues (Asp + Glu): 22
Total number of positively charged residues (Arg + Lys): 17

Atomic composition:

Carbon      C	       739
Hydrogen    H	      1187
Nitrogen    N	       187
Oxygen      O	       223
Sulfur      S	         6

Formula: C739H1187N187O223S6
Total number of atoms: 2342

Extinction coefficients:

Conditions: 6.0 M guanidium hydrochloride
            0.02 M phosphate buffer
            pH 6.5

Extinction coefficients are in units of  M-1 cm-1 .

                      276     278     279     280     282
                       nm      nm      nm      nm      nm
Ext. coefficient     8300    8400    8350    8250    8000
Abs 0.1% (=1 g/l)   0.504   0.511   0.508   0.501   0.486


Estimated half-life:

The N-terminal of the sequence considered is M (Met).

The estimated half-life is: 30 hours (mammalian reticulocytes, in vitro).
                            >20 hours (yeast, in vivo).
                            >10 hours (Escherichia coli, in vivo).


Instability index:

The instability index (II) is computed to be 60.90
This classifies the protein as unstable.



Aliphatic index: 94.22

Grand average of hydropathicity (GRAVY): -0.109

Back to Top