|
|
This gene has the annotation "conserved hypothetical protein".
The target was selected as part of pre-BSGC set.
Available sections:
| Experiment | Result | User | Experiment Date |
|---|---|---|---|
| Selected | Done | jmc | 2001-09-10 |
| Cloned | Done | abwaight | 2001-09-10 |
| Expression tested | Done | abwaight | 2001-09-10 |
| Solubility tested | S | abwaight | 2001-09-10 |
| Purified | Done | abwaight | 2001-09-10 |
| Crystallized | Done | abwaight | 2001-09-10 |
| Diffraction quality crystals | Done | abwaight | 2001-09-10 |
| Phasing diffraction data | Done | abwaight | 2001-09-10 |
| Traceable map | Done | abwaight | 2001-09-10 |
| Crystal structure | Done | abwaight | 2001-09-10 |
| In PDB | 1MJH | abwaight | 2001-09-10 |
| Biochemical function | Done | dhshin | 2001-09-09 |
GTGAGTGTTATGTATAAAAAGATTCTTTATCCAACTGACTTCTCTGAAACTGCTGAGATTGCATTAAAGCATGTTAAGGC GTTTAAAACTCTTAAGGCGGAAGAAGTTATTTTACTGCATGTTATAGATGAAAGAGAAATCAAAAAGAGAGATATATTCT CTCTACTCTTAGGTGTTGCAGGTTTGAATAAATCAGTTGAGGAGTTTGAAAATGAGCTAAAGAATAAACTTACTGAAGAA GCTAAAAATAAAATGGAAAATATCAAAAAAGAACTTGAAGATGTTGGATTTAAAGTTAAGGATATTATTGTTGTAGGAAT TCCTCATGAAGAAATTGTTAAAATAGCTGAAGATGAGGGAGTAGATATAATTATAATGGGTTCTCATGGAAAAACAAACT TAAAAGAGATATTACTTGGTTCAGTTACTGAAAATGTCATTAAAAAATCAAACAAACCAGTTTTAGTTGTTAAAAGAAAA AATAGCTAA
(163 codons) fields: [triplet] [frequency: per thousand] ([number]) UUU18.4( 3) UCU18.4( 3) UAU12.3( 2) UGU0.0( 0) UUC12.3( 2) UCC0.0( 0) UAC0.0( 0) UGC0.0( 0) UUA36.8( 6) UCA18.4( 3) UAA6.1( 1) UGA0.0( 0) UUG6.1( 1) UCG0.0( 0) UAG0.0( 0) UGG0.0( 0) CUU30.7( 5) CCU6.1( 1) CAU24.5( 4) CGU0.0( 0) CUC6.1( 1) CCC0.0( 0) CAC0.0( 0) CGC0.0( 0) CUA12.3( 2) CCA12.3( 2) CAA0.0( 0) CGA0.0( 0) CUG6.1( 1) CCG0.0( 0) CAG0.0( 0) CGG0.0( 0) AUU55.2( 9) ACU30.7( 5) AAU42.9( 7) AGU6.1( 1) AUC12.3( 2) ACC0.0( 0) AAC12.3( 2) AGC6.1( 1) AUA36.8( 6) ACA6.1( 1) AAA110.4( 18) AGA18.4( 3) AUG18.4( 3) ACG0.0( 0) AAG42.9( 7) AGG0.0( 0) GUU85.9( 14) GCU18.4( 3) GAU36.8( 6) GGU24.5( 4) GUC6.1( 1) GCC0.0( 0) GAC6.1( 1) GGC0.0( 0) GUA12.3( 2) GCA12.3( 2) GAA92.0( 15) GGA24.5( 4) GUG6.1( 1) GCG12.3( 2) GAG36.8( 6) GGG0.0( 0)
Note: These were generated using Hisao's algorithm, and do not take into account possible mispriming, self-complementarity, or requirements for mutations anywhere in the sequences. The -R1 primers are for the N-terminal end, and begin with an NdeI restriction site (CATATG). The -R2 primers are for the C-terminal end, and begin with a BamHI site (GGATCC) if the target has no other BamHI sites. If the target does have a BamHI site, the -R2 primer wil begin with a BglII site (AGATCT), unless the target has no BglII sites. If the target has both sites, the design program gives up and doesn't prepend a restriction site to the -R2 primer!
Predicted Tm was obtained using the Tm determination tool at the Virtual Genome Center.
| Primer ID | Predicted Tm | sequence |
|---|---|---|
| 1197B-R1 | 60.80 | CATATGAGTGTTATGTATAAAAAGATTCTTTATCCA |
| 1197B-R2 | 61.80 | GGATCCTTAGCTATTTTTTCTTTTAACAACTAAAACTGG |
| 1197B-R10 | 64.40 | GGCGGTGGTGGCGGCATGAGTGTTATGTATAAAAAGATTCTTTATCCAACTG |
| 1197B-R11 | 63.00 | GTTCTTCTCCTTTGCGCCCCTAGCTATTTTTTCTTTTAACAACTAAAACTGGTTT |
Note: This was generated using the standard codon usage table; UGA codons in MP/MP genes will show up as terminators ("*")
gtgagtgttatgtataaaaagattctttatccaactgacttctctgaaactgctgagatt V S V M Y K K I L Y P T D F S E T A E I gcattaaagcatgttaaggcgtttaaaactcttaaggcggaagaagttattttactgcat A L K H V K A F K T L K A E E V I L L H gttatagatgaaagagaaatcaaaaagagagatatattctctctactcttaggtgttgca V I D E R E I K K R D I F S L L L G V A ggtttgaataaatcagttgaggagtttgaaaatgagctaaagaataaacttactgaagaa G L N K S V E E F E N E L K N K L T E E gctaaaaataaaatggaaaatatcaaaaaagaacttgaagatgttggatttaaagttaag A K N K M E N I K K E L E D V G F K V K gatattattgttgtaggaattcctcatgaagaaattgttaaaatagctgaagatgaggga D I I V V G I P H E E I V K I A E D E G gtagatataattataatgggttctcatggaaaaacaaacttaaaagagatattacttggt V D I I I M G S H G K T N L K E I L L G tcagttactgaaaatgtcattaaaaaatcaaacaaaccagttttagttgttaaaagaaaa S V T E N V I K K S N K P V L V V K R K aatagctaa N S *
MSVMYKKILYPTDFSETAEIALKHVKAFKTLKAEEVILLHVIDEREIKKRDIFSLLLGVAGLNKSVEEFENELKNKLTEE AKNKMENIKKELEDVGFKVKDIIVVGIPHEEIVKIAEDEGVDIIIMGSHGKTNLKEILLGSVTENVIKKSNKPVLVVKRK NS
This information was obtained using the Protein Parameters tool on the ExPASy Molecular Biology Server.
Number of amino acids: 162
Molecular weight: 18338.5
Theoretical pI: 6.93
Amino acid composition:
Ala (A) 7 4.3%
Arg (R) 3 1.9%
Asn (N) 9 5.6%
Asp (D) 7 4.3%
Cys (C) 0 0.0%
Gln (Q) 0 0.0%
Glu (E) 21 13.0%
Gly (G) 8 4.9%
His (H) 4 2.5%
Ile (I) 17 10.5%
Leu (L) 16 9.9%
Lys (K) 25 15.4%
Met (M) 4 2.5%
Phe (F) 5 3.1%
Pro (P) 3 1.9%
Ser (S) 8 4.9%
Thr (T) 6 3.7%
Trp (W) 0 0.0%
Tyr (Y) 2 1.2%
Val (V) 17 10.5%
Asx (B) 0 0.0%
Glx (Z) 0 0.0%
Xaa (X) 0 0.0%
Total number of negatively charged residues (Asp + Glu): 28
Total number of positively charged residues (Arg + Lys): 28
Atomic composition:
Carbon C 827
Hydrogen H 1379
Nitrogen N 213
Oxygen O 244
Sulfur S 4
Formula: C827H1379N213O244S4
Total number of atoms: 2667
Extinction coefficients:
Conditions: 6.0 M guanidium hydrochloride
0.02 M phosphate buffer
pH 6.5
Extinction coefficients are in units of M-1 cm-1 .
276 278 279 280 282
nm nm nm nm nm
Ext. coefficient 2900 2800 2690 2560 2400
Abs 0.1% (=1 g/l) 0.158 0.153 0.147 0.140 0.131
Estimated half-life:
The N-terminal of the sequence considered is M (Met).
The estimated half-life is: 30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Instability index:
The instability index (II) is computed to be 37.37
This classifies the protein as stable.
Aliphatic index: 114.20
Grand average of hydropathicity (GRAVY): -0.195