|
|
This gene has the annotation "ribonuclease P protein component".
The target was selected as part of pre-BSGC set.
Available sections:
| Experiment | Result | User | Experiment Date |
|---|---|---|---|
| Selected | Done | jmc | 2001-09-10 |
| Cloned | Done | abwaight | 2001-09-10 |
| Expression tested | Done | abwaight | 2001-09-10 |
| Solubility tested | S | abwaight | 2001-09-10 |
| Purified | Done | abwaight | 2001-09-10 |
| Crystallized | Done | abwaight | 2001-09-10 |
| Diffraction quality crystals | Done | abwaight | 2001-09-10 |
| Phasing diffraction data | Done | abwaight | 2001-09-10 |
| Traceable map | Done | weiru | 2002-05-08 |
| Crystal structure | Done | weiru | 2002-05-08 |
| In PDB | 1NZ0 | dhshin | 2003-03-18 |
| Biochemical function | Done | dhshin | 2003-01-23 |
| MP gene | log10(PSIBLAST E) | % identical | % coverage (of MP gene) |
|---|---|---|---|
| MP161 / MPN681 | -13.22 | 20.72 | 94.87 |
ATGACAGAGAGTTTCACCCGCAGAGAACGCCTGAGGCTCAGGAGAGATTTCCTGTTAATATTCAAAGAGGGGAAAAGTCT TCAAAACGAGTACTTTGTGGTTCTTTTCAGGAAAAACGGGCTTGATTATTCCAGACTGGGAATAGTTGTGAAAAGAAAGT TCGGAAAGGCGACCAGAAGAAACAAACTGAAAAGATGGGTGAGGGAGATATTCAGAAGGAACAAAGGCGTAATTCCAAAG GGTTTTGACATAGTAGTGATTCCCAGAAAGAAACTGTCAGAAGAATTCGAACGAGTGGATTTCTGGACAGTACGTGAAAA GCTTTTGAATCTCTTGAAGAGGATAGAAGGATGA
(118 codons) fields: [triplet] [frequency: per thousand] ([number]) UUU16.9( 2) UCU0.0( 0) UAU8.5( 1) UGU0.0( 0) UUC67.8( 8) UCC8.5( 1) UAC8.5( 1) UGC0.0( 0) UUA8.5( 1) UCA8.5( 1) UAA0.0( 0) UGA8.5( 1) UUG16.9( 2) UCG0.0( 0) UAG0.0( 0) UGG16.9( 2) CUU33.9( 4) CCU0.0( 0) CAU0.0( 0) CGU8.5( 1) CUC16.9( 2) CCC8.5( 1) CAC0.0( 0) CGC16.9( 2) CUA0.0( 0) CCA8.5( 1) CAA8.5( 1) CGA8.5( 1) CUG42.4( 5) CCG0.0( 0) CAG0.0( 0) CGG0.0( 0) AUU16.9( 2) ACU0.0( 0) AAU8.5( 1) AGU16.9( 2) AUC0.0( 0) ACC16.9( 2) AAC33.9( 4) AGC0.0( 0) AUA42.4( 5) ACA16.9( 2) AAA67.8( 8) AGA76.3( 9) AUG8.5( 1) ACG0.0( 0) AAG50.8( 6) AGG50.8( 6) GUU16.9( 2) GCU0.0( 0) GAU25.4( 3) GGU8.5( 1) GUC0.0( 0) GCC0.0( 0) GAC8.5( 1) GGC8.5( 1) GUA25.4( 3) GCA0.0( 0) GAA50.8( 6) GGA25.4( 3) GUG42.4( 5) GCG8.5( 1) GAG33.9( 4) GGG16.9( 2)
Note: These were generated using Hisao's algorithm, and do not take into account possible mispriming, self-complementarity, or requirements for mutations anywhere in the sequences. The -R1 primers are for the N-terminal end, and begin with an NdeI restriction site (CATATG). The -R2 primers are for the C-terminal end, and begin with a BamHI site (GGATCC) if the target has no other BamHI sites. If the target does have a BamHI site, the -R2 primer wil begin with a BglII site (AGATCT), unless the target has no BglII sites. If the target has both sites, the design program gives up and doesn't prepend a restriction site to the -R2 primer!
Predicted Tm was obtained using the Tm determination tool at the Virtual Genome Center.
| Primer ID | Predicted Tm | sequence |
|---|---|---|
| 1202B-R1 | 61.50 | CATATGACAGAGAGTTTCACCCGC |
| 1202B-R2 | 61.40 | GGATCCTTATCATCCTTTCCTCTTCAAGAGATTC |
| 1202B-R3 | 61.10 | GGATCCTTATCCTTCTATCCTCTTCAAGAGATTCA |
| 1202B-R10 | 64.20 | GGCGGTGGTGGCGGCATGACAGAGAGTTTCACCCGCA |
| 1202B-R11 | 63.00 | GTTCTTCTCCTTTGCGCCCCTATCCTTCTATCCTCTTCAAGAGATTCAAA |
Note: This was generated using the standard codon usage table; UGA codons in MP/MP genes will show up as terminators ("*")
atgacagagagtttcacccgcagagaacgcctgaggctcaggagagatttcctgttaata M T E S F T R R E R L R L R R D F L L I ttcaaagaggggaaaagtcttcaaaacgagtactttgtggttcttttcaggaaaaacggg F K E G K S L Q N E Y F V V L F R K N G cttgattattccagactgggaatagttgtgaaaagaaagttcggaaaggcgaccagaaga L D Y S R L G I V V K R K F G K A T R R aacaaactgaaaagatgggtgagggagatattcagaaggaacaaaggcgtaattccaaag N K L K R W V R E I F R R N K G V I P K ggttttgacatagtagtgattcccagaaagaaactgtcagaagaattcgaacgagtggat G F D I V V I P R K K L S E E F E R V D ttctggacagtacgtgaaaagcttttgaatctcttgaagaggatagaaggatga F W T V R E K L L N L L K R I E G *
MTESFTRRERLRLRRDFLLIFKEGKSLQNEYFVVLFRKNGLDYSRLGIVVKRKFGKATRRNKLKRWVREIFRRNKGVIPK GFDIVVIPRKKLSEEFERVDFWTVREKLLNLLKRIEG
This information was obtained using the Protein Parameters tool on the ExPASy Molecular Biology Server.
Number of amino acids: 117
Molecular weight: 14316.9
Theoretical pI: 11.25
Amino acid composition:
Ala (A) 1 0.9%
Arg (R) 19 16.2%
Asn (N) 5 4.3%
Asp (D) 4 3.4%
Cys (C) 0 0.0%
Gln (Q) 1 0.9%
Glu (E) 10 8.5%
Gly (G) 7 6.0%
His (H) 0 0.0%
Ile (I) 7 6.0%
Leu (L) 14 12.0%
Lys (K) 14 12.0%
Met (M) 1 0.9%
Phe (F) 10 8.5%
Pro (P) 2 1.7%
Ser (S) 4 3.4%
Thr (T) 4 3.4%
Trp (W) 2 1.7%
Tyr (Y) 2 1.7%
Val (V) 10 8.5%
Asx (B) 0 0.0%
Glx (Z) 0 0.0%
Xaa (X) 0 0.0%
Total number of negatively charged residues (Asp + Glu): 14
Total number of positively charged residues (Arg + Lys): 33
Atomic composition:
Carbon C 655
Hydrogen H 1072
Nitrogen N 196
Oxygen O 162
Sulfur S 1
Formula: C655H1072N196O162S1
Total number of atoms: 2086
Extinction coefficients:
Conditions: 6.0 M guanidium hydrochloride
0.02 M phosphate buffer
pH 6.5
Extinction coefficients are in units of M-1 cm-1 .
276 278 279 280 282
nm nm nm nm nm
Ext. coefficient 13700 14000 14010 13940 13600
Abs 0.1% (=1 g/l) 0.957 0.978 0.979 0.974 0.950
Estimated half-life:
The N-terminal of the sequence considered is M (Met).
The estimated half-life is: 30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Instability index:
The instability index (II) is computed to be 53.33
This classifies the protein as unstable.
Aliphatic index: 95.64
Grand average of hydropathicity (GRAVY): -0.582