Berkeley Structural Genomics Center

Target info for 1202B

This target is gi number 4982028 from Thermotoga maritima.

This gene has the annotation "ribonuclease P protein component".

The target was selected as part of pre-BSGC set.

Available sections:


Experimental status of 1202B

Note: Dates prior to 10/24/01 may be inaccurate, due to conversion from a record-keeping system which tracked only the last experimental date, to a new system which keeps track of all dates. The user is the person who entered the data, not the person who did the experiment. This will also change in the future.

ExperimentResultUserExperiment Date
SelectedDonejmc2001-09-10
ClonedDoneabwaight2001-09-10
Expression testedDoneabwaight2001-09-10
Solubility testedSabwaight2001-09-10
PurifiedDoneabwaight2001-09-10
CrystallizedDoneabwaight2001-09-10
Diffraction quality crystalsDoneabwaight2001-09-10
Phasing diffraction dataDoneabwaight2001-09-10
Traceable mapDoneweiru2002-05-08
Crystal structureDoneweiru2002-05-08
In PDB1NZ0dhshin2003-03-18
Biochemical functionDonedhshin2003-01-23

Back to Top


Potential MP Homologues of 1202B

MP genelog10(PSIBLAST E)% identical% coverage (of MP gene)
MP161 / MPN681-13.2220.7294.87

Back to Top


1202B DNA sequence

ATGACAGAGAGTTTCACCCGCAGAGAACGCCTGAGGCTCAGGAGAGATTTCCTGTTAATATTCAAAGAGGGGAAAAGTCT
TCAAAACGAGTACTTTGTGGTTCTTTTCAGGAAAAACGGGCTTGATTATTCCAGACTGGGAATAGTTGTGAAAAGAAAGT
TCGGAAAGGCGACCAGAAGAAACAAACTGAAAAGATGGGTGAGGGAGATATTCAGAAGGAACAAAGGCGTAATTCCAAAG
GGTTTTGACATAGTAGTGATTCCCAGAAAGAAACTGTCAGAAGAATTCGAACGAGTGGATTTCTGGACAGTACGTGAAAA
GCTTTTGAATCTCTTGAAGAGGATAGAAGGATGA

Back to Top


1202B Codon Usage

(118 codons)
fields: [triplet] [frequency: per thousand] ([number])

UUU16.9(   2)  UCU0.0(   0)  UAU8.5(   1)  UGU0.0(   0)  
UUC67.8(   8)  UCC8.5(   1)  UAC8.5(   1)  UGC0.0(   0)  
UUA8.5(   1)  UCA8.5(   1)  UAA0.0(   0)  UGA8.5(   1)  
UUG16.9(   2)  UCG0.0(   0)  UAG0.0(   0)  UGG16.9(   2)  

CUU33.9(   4)  CCU0.0(   0)  CAU0.0(   0)  CGU8.5(   1)  
CUC16.9(   2)  CCC8.5(   1)  CAC0.0(   0)  CGC16.9(   2)  
CUA0.0(   0)  CCA8.5(   1)  CAA8.5(   1)  CGA8.5(   1)  
CUG42.4(   5)  CCG0.0(   0)  CAG0.0(   0)  CGG0.0(   0)  

AUU16.9(   2)  ACU0.0(   0)  AAU8.5(   1)  AGU16.9(   2)  
AUC0.0(   0)  ACC16.9(   2)  AAC33.9(   4)  AGC0.0(   0)  
AUA42.4(   5)  ACA16.9(   2)  AAA67.8(   8)  AGA76.3(   9)  
AUG8.5(   1)  ACG0.0(   0)  AAG50.8(   6)  AGG50.8(   6)  

GUU16.9(   2)  GCU0.0(   0)  GAU25.4(   3)  GGU8.5(   1)  
GUC0.0(   0)  GCC0.0(   0)  GAC8.5(   1)  GGC8.5(   1)  
GUA25.4(   3)  GCA0.0(   0)  GAA50.8(   6)  GGA25.4(   3)  
GUG42.4(   5)  GCG8.5(   1)  GAG33.9(   4)  GGG16.9(   2)  

Back to Top


1202B Potential Cloning Problems

No UGA codons or (bad) restriction sites!

Back to Top


1202B Automatically Selected Primers

Note: These were generated using Hisao's algorithm, and do not take into account possible mispriming, self-complementarity, or requirements for mutations anywhere in the sequences. The -R1 primers are for the N-terminal end, and begin with an NdeI restriction site (CATATG). The -R2 primers are for the C-terminal end, and begin with a BamHI site (GGATCC) if the target has no other BamHI sites. If the target does have a BamHI site, the -R2 primer wil begin with a BglII site (AGATCT), unless the target has no BglII sites. If the target has both sites, the design program gives up and doesn't prepend a restriction site to the -R2 primer!

Predicted Tm was obtained using the Tm determination tool at the Virtual Genome Center.

Primer IDPredicted Tmsequence
1202B-R161.50CATATGACAGAGAGTTTCACCCGC
1202B-R261.40GGATCCTTATCATCCTTTCCTCTTCAAGAGATTC
1202B-R361.10GGATCCTTATCCTTCTATCCTCTTCAAGAGATTCA
1202B-R1064.20GGCGGTGGTGGCGGCATGACAGAGAGTTTCACCCGCA
1202B-R1163.00GTTCTTCTCCTTTGCGCCCCTATCCTTCTATCCTCTTCAAGAGATTCAAA

Back to Top


1202B Translation

Note: This was generated using the standard codon usage table; UGA codons in MP/MP genes will show up as terminators ("*")

atgacagagagtttcacccgcagagaacgcctgaggctcaggagagatttcctgttaata
 M  T  E  S  F  T  R  R  E  R  L  R  L  R  R  D  F  L  L  I 
ttcaaagaggggaaaagtcttcaaaacgagtactttgtggttcttttcaggaaaaacggg
 F  K  E  G  K  S  L  Q  N  E  Y  F  V  V  L  F  R  K  N  G 
cttgattattccagactgggaatagttgtgaaaagaaagttcggaaaggcgaccagaaga
 L  D  Y  S  R  L  G  I  V  V  K  R  K  F  G  K  A  T  R  R 
aacaaactgaaaagatgggtgagggagatattcagaaggaacaaaggcgtaattccaaag
 N  K  L  K  R  W  V  R  E  I  F  R  R  N  K  G  V  I  P  K 
ggttttgacatagtagtgattcccagaaagaaactgtcagaagaattcgaacgagtggat
 G  F  D  I  V  V  I  P  R  K  K  L  S  E  E  F  E  R  V  D 
ttctggacagtacgtgaaaagcttttgaatctcttgaagaggatagaaggatga
 F  W  T  V  R  E  K  L  L  N  L  L  K  R  I  E  G  * 

Back to Top


1202B AA Sequence

MTESFTRRERLRLRRDFLLIFKEGKSLQNEYFVVLFRKNGLDYSRLGIVVKRKFGKATRRNKLKRWVREIFRRNKGVIPK
GFDIVVIPRKKLSEEFERVDFWTVREKLLNLLKRIEG

Back to Top


1202B Protein Parameters

This information was obtained using the Protein Parameters tool on the ExPASy Molecular Biology Server.

Number of amino acids: 117

Molecular weight: 14316.9

Theoretical pI: 11.25

Amino acid composition:

Ala (A)   1	  0.9%
Arg (R)  19	 16.2%
Asn (N)   5	  4.3%
Asp (D)   4	  3.4%
Cys (C)   0	  0.0%
Gln (Q)   1	  0.9%
Glu (E)  10	  8.5%
Gly (G)   7	  6.0%
His (H)   0	  0.0%
Ile (I)   7	  6.0%
Leu (L)  14	 12.0%
Lys (K)  14	 12.0%
Met (M)   1	  0.9%
Phe (F)  10	  8.5%
Pro (P)   2	  1.7%
Ser (S)   4	  3.4%
Thr (T)   4	  3.4%
Trp (W)   2	  1.7%
Tyr (Y)   2	  1.7%
Val (V)  10	  8.5%

Asx (B)   0	  0.0%
Glx (Z)   0	  0.0%
Xaa (X)   0	  0.0%

Total number of negatively charged residues (Asp + Glu): 14
Total number of positively charged residues (Arg + Lys): 33

Atomic composition:

Carbon      C	       655
Hydrogen    H	      1072
Nitrogen    N	       196
Oxygen      O	       162
Sulfur      S	         1

Formula: C655H1072N196O162S1
Total number of atoms: 2086

Extinction coefficients:

Conditions: 6.0 M guanidium hydrochloride
            0.02 M phosphate buffer
            pH 6.5

Extinction coefficients are in units of  M-1 cm-1 .

                      276     278     279     280     282
                       nm      nm      nm      nm      nm
Ext. coefficient    13700   14000   14010   13940   13600
Abs 0.1% (=1 g/l)   0.957   0.978   0.979   0.974   0.950


Estimated half-life:

The N-terminal of the sequence considered is M (Met).

The estimated half-life is: 30 hours (mammalian reticulocytes, in vitro).
                            >20 hours (yeast, in vivo).
                            >10 hours (Escherichia coli, in vivo).


Instability index:

The instability index (II) is computed to be 53.33
This classifies the protein as unstable.



Aliphatic index: 95.64

Grand average of hydropathicity (GRAVY): -0.582

Back to Top