Berkeley Structural Genomics Center

Target info for 1022B

This target is gi number 3258135 from Pyrococcus horikoshii.

This gene has the annotation "166aa long hypothetical intracellular proteinase".

The target was selected as part of Igor's sets.

Available sections:


Experimental status of 1022B

Note: Dates prior to 10/24/01 may be inaccurate, due to conversion from a record-keeping system which tracked only the last experimental date, to a new system which keeps track of all dates. The user is the person who entered the data, not the person who did the experiment. This will also change in the future.

ExperimentResultUserExperiment Date
SelectedDonejmc2001-08-24
ClonedDoneabwaight2001-08-24
Expression testedDoneabwaight2001-08-24
Solubility testedSabwaight2001-08-24
PurifiedDoneabwaight2001-08-24
CrystallizedDoneabwaight2001-08-24
Diffraction quality crystalsDoneabwaight2001-08-24
Phasing diffraction dataDoneabwaight2001-08-24
Traceable mapDoneabwaight2001-08-24
Crystal structureDoneabwaight2001-08-24
In PDB1G2Iabwaight2001-08-24

Back to Top


Potential MP Homologues of 1022B

MP genelog10(PSIBLAST E)% identical% coverage (of MP gene)
MP122 / MPN032-14.7025.7163.25
MP541 / MPN294-19.1518.7999.40

Back to Top


1022B DNA sequence

GTGAAGGTACTATTCTTAACAGCGAACGAGTTTGAGGATGTGGAACTAATTTACCCTTACCATAGGCTTAAAGAAGAGGG
ACATGAAGTTTACATAGCAAGCTTTGAAAGGGGAACAATTACAGGGAAACATGGATATTCAGTTAAGGTTGACTTGACTT
TCGATAAAGTTAATCCCGAGGAGTTTGATGCATTAGTCCTTCCAGGAGGAAGGGCACCGGAAAGGGTAAGATTAAATGAG
AAAGCTGTGAGCATAGCCAGAAAGATGTTCAGTGAAGGAAAGCCCGTTGCTAGCATATGCCATGGTCCTCAAATCTTGAT
TTCTGCTGGAGTTCTAAGGGGTAGAAAGGGAACAAGCTATCCTGGGATTAAGGATGACATGATAAATGCAGGGGTTGAAT
GGGTTGATGCAGAGGTAGTTGTTGATGGGAACTGGGTTAGCTCCAGGGTTCCAGCTGATCTTTATGCCTGGATGAGGGAA
TTTGTAAAGTTACTTAAATGA

Back to Top


1022B Codon Usage

(167 codons)
fields: [triplet] [frequency: per thousand] ([number])

UUU24.0(   4)  UCU6.0(   1)  UAU18.0(   3)  UGU0.0(   0)  
UUC18.0(   3)  UCC6.0(   1)  UAC18.0(   3)  UGC6.0(   1)  
UUA24.0(   4)  UCA6.0(   1)  UAA0.0(   0)  UGA6.0(   1)  
UUG12.0(   2)  UCG0.0(   0)  UAG0.0(   0)  UGG18.0(   3)  

CUU24.0(   4)  CCU18.0(   3)  CAU24.0(   4)  CGU0.0(   0)  
CUC0.0(   0)  CCC12.0(   2)  CAC0.0(   0)  CGC0.0(   0)  
CUA18.0(   3)  CCA12.0(   2)  CAA6.0(   1)  CGA0.0(   0)  
CUG0.0(   0)  CCG6.0(   1)  CAG0.0(   0)  CGG0.0(   0)  

AUU24.0(   4)  ACU6.0(   1)  AAU18.0(   3)  AGU6.0(   1)  
AUC6.0(   1)  ACC0.0(   0)  AAC12.0(   2)  AGC29.9(   5)  
AUA24.0(   4)  ACA24.0(   4)  AAA29.9(   5)  AGA18.0(   3)  
AUG18.0(   3)  ACG0.0(   0)  AAG41.9(   7)  AGG41.9(   7)  

GUU71.9(  12)  GCU24.0(   4)  GAU41.9(   7)  GGU12.0(   2)  
GUC6.0(   1)  GCC12.0(   2)  GAC12.0(   2)  GGC0.0(   0)  
GUA24.0(   4)  GCA29.9(   5)  GAA47.9(   8)  GGA47.9(   8)  
GUG18.0(   3)  GCG6.0(   1)  GAG41.9(   7)  GGG24.0(   4)  

Back to Top


1022B Potential Cloning Problems

No UGA codons.
1 restriction site(s) found.

Details (problem DNA region is in upper case, with the key on the line below):

Key:

gtgaaggtactattcttaacagcgaacgagtttgaggatgtggaactaatttacccttac
                                                            
cataggcttaaagaagagggacatgaagtttacatagcaagctttgaaaggggaacaatt
                                                            
acagggaaacatggatattcagttaaggttgacttgactttcgataaagttaatcccgag
                                                            
gagtttgatgcattagtccttccaggaggaagggcaccggaaagggtaagattaaatgag
                                                            
aaagctgtgagcatagccagaaagatgttcagtgaaggaaagcccgttgctagCATATGc
                                                     1      
catggtcctcaaatcttgatttctgctggagttctaaggggtagaaagggaacaagctat
                                                            
cctgggattaaggatgacatgataaatgcaggggttgaatgggttgatgcagaggtagtt
                                                            
gttgatgggaactgggttagctccagggttccagctgatctttatgcctggatgagggaa
                                                            
tttgtaaagttacttaaatga
                     

Back to Top


1022B Automatically Selected Primers

Note: These were generated using Hisao's algorithm, and do not take into account possible mispriming, self-complementarity, or requirements for mutations anywhere in the sequences. The -R1 primers are for the N-terminal end, and begin with an NdeI restriction site (CATATG). The -R2 primers are for the C-terminal end, and begin with a BamHI site (GGATCC) if the target has no other BamHI sites. If the target does have a BamHI site, the -R2 primer wil begin with a BglII site (AGATCT), unless the target has no BglII sites. If the target has both sites, the design program gives up and doesn't prepend a restriction site to the -R2 primer!

Predicted Tm was obtained using the Tm determination tool at the Virtual Genome Center.

Primer IDPredicted Tmsequence
1022B-R162.90CATATGAAGGTACTATTCTTAACAGCGAACG
1022B-R261.10GGATCCTTATCATTTAAACTTTACAAATTCCCTCATC
1022B-R361.40GGATCCTTATTTAAGTAACTTTACAAATTCCCTCATCC
1022B-R1064.30GGCGGTGGTGGCGGCATGAAGGTACTATTCTTAACAGCGAACGA
1022B-R1163.20GTTCTTCTCCTTTGCGCCCCTATTTAAGTAACTTTACAAATTCCCTCATCCA

Back to Top


1022B Translation

Note: This was generated using the standard codon usage table; UGA codons in MP/MP genes will show up as terminators ("*")

gtgaaggtactattcttaacagcgaacgagtttgaggatgtggaactaatttacccttac
 V  K  V  L  F  L  T  A  N  E  F  E  D  V  E  L  I  Y  P  Y 
cataggcttaaagaagagggacatgaagtttacatagcaagctttgaaaggggaacaatt
 H  R  L  K  E  E  G  H  E  V  Y  I  A  S  F  E  R  G  T  I 
acagggaaacatggatattcagttaaggttgacttgactttcgataaagttaatcccgag
 T  G  K  H  G  Y  S  V  K  V  D  L  T  F  D  K  V  N  P  E 
gagtttgatgcattagtccttccaggaggaagggcaccggaaagggtaagattaaatgag
 E  F  D  A  L  V  L  P  G  G  R  A  P  E  R  V  R  L  N  E 
aaagctgtgagcatagccagaaagatgttcagtgaaggaaagcccgttgctagcatatgc
 K  A  V  S  I  A  R  K  M  F  S  E  G  K  P  V  A  S  I  C 
catggtcctcaaatcttgatttctgctggagttctaaggggtagaaagggaacaagctat
 H  G  P  Q  I  L  I  S  A  G  V  L  R  G  R  K  G  T  S  Y 
cctgggattaaggatgacatgataaatgcaggggttgaatgggttgatgcagaggtagtt
 P  G  I  K  D  D  M  I  N  A  G  V  E  W  V  D  A  E  V  V 
gttgatgggaactgggttagctccagggttccagctgatctttatgcctggatgagggaa
 V  D  G  N  W  V  S  S  R  V  P  A  D  L  Y  A  W  M  R  E 
tttgtaaagttacttaaatga
 F  V  K  L  L  K  * 

Back to Top


1022B AA Sequence

MKVLFLTANEFEDVELIYPYHRLKEEGHEVYIASFERGTITGKHGYSVKVDLTFDKVNPEEFDALVLPGGRAPERVRLNE
KAVSIARKMFSEGKPVASICHGPQILISAGVLRGRKGTSYPGIKDDMINAGVEWVDAEVVVDGNWVSSRVPADLYAWMRE
FVKLLK

Back to Top


1022B Protein Parameters

This information was obtained using the Protein Parameters tool on the ExPASy Molecular Biology Server.

Number of amino acids: 166

Molecular weight: 18624.4

Theoretical pI: 6.11

Amino acid composition:

Ala (A)  12	  7.2%
Arg (R)  10	  6.0%
Asn (N)   5	  3.0%
Asp (D)   9	  5.4%
Cys (C)   1	  0.6%
Gln (Q)   1	  0.6%
Glu (E)  15	  9.0%
Gly (G)  14	  8.4%
His (H)   4	  2.4%
Ile (I)   9	  5.4%
Leu (L)  13	  7.8%
Lys (K)  12	  7.2%
Met (M)   4	  2.4%
Phe (F)   7	  4.2%
Pro (P)   8	  4.8%
Ser (S)   9	  5.4%
Thr (T)   5	  3.0%
Trp (W)   3	  1.8%
Tyr (Y)   6	  3.6%
Val (V)  19	 11.4%

Asx (B)   0	  0.0%
Glx (Z)   0	  0.0%
Xaa (X)   0	  0.0%

Total number of negatively charged residues (Asp + Glu): 24
Total number of positively charged residues (Arg + Lys): 22

Atomic composition:

Carbon      C	       843
Hydrogen    H	      1321
Nitrogen    N	       225
Oxygen      O	       241
Sulfur      S	         5

Formula: C843H1321N225O241S5
Total number of atoms: 2635

Extinction coefficients:

Conditions: 6.0 M guanidium hydrochloride
            0.02 M phosphate buffer
            pH 6.5

Extinction coefficients are in units of  M-1 cm-1 .

The first table lists values computed assuming ALL Cys 
residues appear as half cystines, whereas the second table 
assumes that NONE do. 

                      276     278     279     280     282
                       nm      nm      nm      nm      nm
Ext. coefficient    24900   25200   25050   24750   24000
Abs 0.1% (=1 g/l)   1.337   1.353   1.345   1.329   1.289



                      276     278     279     280     282
                       nm      nm      nm      nm      nm
Ext. coefficient    24900   25200   25050   24750   24000
Abs 0.1% (=1 g/l)   1.337   1.353   1.345   1.329   1.289


Estimated half-life:

The N-terminal of the sequence considered is M (Met).

The estimated half-life is: 30 hours (mammalian reticulocytes, in vitro).
                            >20 hours (yeast, in vivo).
                            >10 hours (Escherichia coli, in vivo).


Instability index:

The instability index (II) is computed to be 23.24
This classifies the protein as stable.



Aliphatic index: 92.11

Grand average of hydropathicity (GRAVY): -0.170

Back to Top