|
|
This gene has the annotation "conserved hypothetical protein".
The target was selected as part of Igor's other set.
Available sections:
| Experiment | Result | User | Experiment Date |
|---|---|---|---|
| Selected | Done | jmc | 2001-12-05 |
| Cloned | Done | dhshin | 2003-11-13 |
| Expression tested | Done | dhshin | 2003-11-13 |
| Solubility tested | S | dhshin | 2004-01-29 |
| Purified | Done | dhshin | 2004-01-29 |
| Crystallized | Done | dhshin | 2004-01-29 |
| Diffraction quality crystals | Done | dhshin | 2004-03-03 |
| Native diffraction data | Done | dhshin | 2004-04-07 |
| Phasing diffraction data | Done | dhshin | 2004-05-25 |
| Traceable map | Done | dhshin | 2004-05-25 |
| Crystal structure | Done | dhshin | 2004-06-09 |
| In PDB | 1U0L | dhshin | 2004-07-13 |
| Suggested work stop | 0 670 670 670 670 670 670 670 670 670 670 670 1219 1219 1219 1219 1219 1219 1219 1219 1219 3146 3146 3146 3146 3146 3146 3146 3146 3146 3146 3146 3146 3289 3289 3289 3289 3289 3289 3289 3289 3289 3289 3289 3328 3328 3328 3328 3328 3328 3328 3328 3328 3328 3328 3328 3328 3328 3328 3477 3477 3477 3477 3477 3477 3477 3477 3477 4359 4359 4359 4359 4359 4359 4359 4359 4359 4362 4362 4362 4362 4362 4362 4362 4362 4362 4362 4362 4362 4362 4362 4362 4367 4367 4367 4367 4367 4367 4367 4367 4367 4374 4374 4374 4374 4374 4374 4374 4374 4375 4375 4375 4375 4375 4375 4375 4375 4375 4402 4402 4402 4402 4402 4402 4402 4402 4402 4402 4402 4730 4730 4730 4730 4730 4730 4730 4730 4730 4730 4730 4825 4825 4825 4825 4825 4825 4825 4825 4825 4825 5046 5046 5046 5046 5046 5058 5058 5058 5545 5545 5545 5545 5545 5545 5545 5545 5545 5545 5545 5545 5545 5545 5545 6055 6055 6055 6055 6055 6055 6055 6055 6055 6056 6056 6056 6056 6056 6056 6056 6056 6056 6056 8052 8052 8052 8052 8052 8052 8052 8052 8052 8052 8052 12665 12665 12665 12665 13102 13102 13102 13102 13102 13102 13102 13102 13102 13102 13103 13103 13103 13103 13103 13103 13103 13103 13103 13103 13104 13104 13104 13104 13104 13104 13104 13104 13894 13894 13894 13894 13894 13894 13894 13894 13894 13894 13894 13894 13894 15042 15042 15684 15684 15684 15684 15684 15689 15689 15689 15689 15689 15689 16177 16177 16177 16177 16177 16177 16177 16177 16177 16177 16453 16453 16453 16453 16453 16453 16453 16453 16453 17109 17109 17109 17109 17109 17109 17109 17109 17109 17109 17109 17109 17309 17469 17469 18382 18382 18382 18382 18382 18382 18382 18382 18382 20092 20092 20092 20092 20092 20092 20092 20092 20093 20093 20093 20093 20093 20093 20622 20622 20622 20622 20622 20622 20622 20622 20623 20623 20623 20623 20623 20623 22550 22886 22886 22886 22886 22886 22886 22886 22886 22886 22886 23567 23567 23567 23567 24747 24747 24747 24747 24749 24749 24749 24749 24750 24750 24750 24750 27803 27803 27803 27804 27804 27804 27805 27805 27805 27989 27989 27989 27989 28250 28250 28250 29603 29603 29603 29603 29628 29628 29628 29628 29638 29638 29638 29638 29638 29638 29638 29638 29821 29821 29821 29821 29821 29821 29821 32444 32444 32444 34232 34232 34232 34233 34233 34233 34389 34389 34389 34389 34390 34390 34390 34390 38398 38398 38398 38398 38525 38525 38525 38525 38525 38525 38525 40110 40110 40110 40110 40111 40111 40111 40111 40577 40577 40577 40577 40577 40577 40577 40578 40578 40578 40578 40578 40578 40578 41792 41792 41792 41792 41983 41983 41983 41983 42467 42467 42467 44132 44132 44132 44132 44132 44133 44133 44133 44133 44133 49095 49095 49095 49095 49095 49095 49095 49401 49401 49401 51150 51150 51150 51150 52810 52810 52810 52810 52811 52811 52811 52811 52812 52812 52812 52812 52813 52813 52813 52813 52814 52814 52814 52814 52815 52815 52815 52815 54758 54758 54758 54758 54758 54758 54758 58607 58607 59985 | dallen | 2004-04-26 |
| Override suggest work stop | Structure solved | dhshin | 2004-05-25 |
| MP gene | log10(PSIBLAST E) | % identical | % coverage (of MP gene) |
|---|---|---|---|
| MP146 / MPN008 | -9.70 | 26.19 | 28.47 |
| MP177 / MPN665 | -11.70 | 16.98 | 71.86 |
| MP366 | -12.52 | 22.73 | 29.83 |
| MP556 / MPN279 | -55.10 | 17.02 | 95.59 |
| MP583 / MPN249 | -29.10 | 28.57 | 97.29 |
| MP604 / MPN227 | -14.05 | 15.54 | 50.17 |
| MP676 / MPN155 | -61.15 | 15.90 | 95.93 |
ATGAACTTGAGAAGAAGAGGAATAGTGGTGAGTTTTCACTCGAACATGGTCACGGTCGAAGACGAGGAAACTGGTGAAAG AATCCTCTGCAAACTGAGGGGGAAATTTCGCCTGCAGAATCTCAAGATATACGTTGGAGACAGGGTGGAGTACACACCGG ATGAAACAGGATCCGGAGTCATAGAGAACGTGCTACACAGGAAAAATCTACTCACCAAACCTCACGTCGCCAATGTGGAT CAAGTGATTCTCGTGGTAACGGTGAAAATGCCGGAAACTTCGACCTACATAATCGATAAATTTCTTGTTCTCGCTGAAAA GAACGAACTGGAAACGGTGATGGTCATCAACAAGATGGACCTCTACGATGAAGACGATCTGAGGAAGGTAAGAGAGCTGG AAGAGATCTATTCTGGACTCTATCCAATCGTGAAAACCAGTGCGAAAACCGGAATGGGAATCGAAGAGCTCAAGGAATAT CTGAAGGGAAAGATCAGCACGATGGCCGGACTCTCCGGAGTTGGAAAAAGTAGCTTGCTCAACGCCATAAATCCCGGTTT GAAATTACGGGTGAGCGAAGTTTCAGAGAAACTCCAAAGGGGAAGGCATACTACAACAACTGCCCAGCTCTTGAAATTCG ATTTCGGAGGTTACGTAGTCGATACTCCGGGTTTCGCAAATCTGGAGATCAACGACATAGAACCCGAGGAACTGAAACAC TACTTCAAGGAATTTGGAGACAAACAGTGTTTCTTCTCGGACTGCAACCACGTGGATGAACCGGAGTGTGGAGTGAAAGA AGCCGTGGAGAACGGAGAAATCGCAGAAAGTCGATACGAAAACTACGTGAAGATGTTTTACGAGCTTCTGGGAAGGAGGA AAAAGTAA
(296 codons) fields: [triplet] [frequency: per thousand] ([number]) UUU16.9( 5) UCU3.4( 1) UAU10.1( 3) UGU6.8( 2) UUC20.3( 6) UCC6.8( 2) UAC30.4( 9) UGC6.8( 2) UUA3.4( 1) UCA3.4( 1) UAA3.4( 1) UGA0.0( 0) UUG13.5( 4) UCG10.1( 3) UAG0.0( 0) UGG0.0( 0) CUU6.8( 2) CCU3.4( 1) CAU3.4( 1) CGU0.0( 0) CUC40.5( 12) CCC6.8( 2) CAC16.9( 5) CGC3.4( 1) CUA6.8( 2) CCA3.4( 1) CAA6.8( 2) CGA3.4( 1) CUG30.4( 9) CCG13.5( 4) CAG10.1( 3) CGG3.4( 1) AUU3.4( 1) ACU16.9( 5) AAU16.9( 5) AGU13.5( 4) AUC30.4( 9) ACC13.5( 4) AAC33.8( 10) AGC10.1( 3) AUA20.3( 6) ACA13.5( 4) AAA54.1( 16) AGA16.9( 5) AUG27.0( 8) ACG13.5( 4) AAG33.8( 10) AGG27.0( 8) GUU13.5( 4) GCU3.4( 1) GAU27.0( 8) GGU13.5( 4) GUC20.3( 6) GCC16.9( 5) GAC23.6( 7) GGC0.0( 0) GUA10.1( 3) GCA6.8( 2) GAA70.9( 21) GGA57.4( 17) GUG50.7( 15) GCG3.4( 1) GAG40.5( 12) GGG3.4( 1)
Details (problem DNA region is in upper case, with the key on the line below):
Key:
atgaacttgagaagaagaggaatagtggtgagttttcactcgaacatggtcacggtcgaa
gacgaggaaactggtgaaagaatcctctgcaaactgagggggaaatttcgcctgcagaat
ctcaagatatacgttggagacagggtggagtacacaccggatgaaacaGGATCCggagtc
2
atagagaacgtgctacacaggaaaaatctactcaccaaacctcacgtcgccaatgtggat
caagtgattctcgtggtaacggtgaaaatgccggaaacttcgacctacataatcgataaa
tttcttgttctcgctgaaaagaacgaactggaaacggtgatggtcatcaacaagatggac
ctctacgatgaagacgatctgaggaaggtaagagagctggaagAGATCTattctggactc
4
tatccaatcgtgaaaaccagtgcgaaaaccggaatgggaatcgaagagctcaaggaatat
ctgaagggaaagatcagcacgatggccggactctccggagttggaaaaagtagcttgctc
aacgccataaatcccggtttgaaattacgggtgagcgaagtttcagagaaactccaaagg
ggaaggcatactacaacaactgcccagctcttgaaattcgatttcggaggttacgtagtc
gatactccgggtttcgcaaatctggagatcaacgacatagaacccgaggaactgaaacac
tacttcaaggaatttggagacaaacagtgtttcttctcggactgcaaccacgtggatgaa
ccggagtgtggagtgaaagaagccgtggagaacggagaaatcgcagaaagtcgatacgaa
aactacgtgaagatgttttacgagcttctgggaaggaggaaaaagtaa
Note: These were generated using Hisao's algorithm, and do not take into account possible mispriming, self-complementarity, or requirements for mutations anywhere in the sequences. The -R1 primers are for the N-terminal end, and begin with an NdeI restriction site (CATATG). The -R2 primers are for the C-terminal end, and begin with a BamHI site (GGATCC) if the target has no other BamHI sites. If the target does have a BamHI site, the -R2 primer wil begin with a BglII site (AGATCT), unless the target has no BglII sites. If the target has both sites, the design program gives up and doesn't prepend a restriction site to the -R2 primer!
Predicted Tm was obtained using the Tm determination tool at the Virtual Genome Center.
| Primer ID | Predicted Tm | sequence |
|---|---|---|
| 1234B-R1 | 62.50 | CATATGAACTTGAGAAGAAGAGGAATAGTGG |
| 1234B-R2 | 60.30 | TTACTTTTTCCTCCTTCCCAGAA |
| 1234B-R10 | 63.10 | GGCGGTGGTGGCGGCATGAACTTGAGAAGAAGAGGAATAGTGGT |
| 1234B-R11 | 63.10 | GTTCTTCTCCTTTGCGCCCCTACTTTTTCCTCCTTCCCAGAAGC |
Note: This was generated using the standard codon usage table; UGA codons in MP/MP genes will show up as terminators ("*")
atgaacttgagaagaagaggaatagtggtgagttttcactcgaacatggtcacggtcgaa M N L R R R G I V V S F H S N M V T V E gacgaggaaactggtgaaagaatcctctgcaaactgagggggaaatttcgcctgcagaat D E E T G E R I L C K L R G K F R L Q N ctcaagatatacgttggagacagggtggagtacacaccggatgaaacaggatccggagtc L K I Y V G D R V E Y T P D E T G S G V atagagaacgtgctacacaggaaaaatctactcaccaaacctcacgtcgccaatgtggat I E N V L H R K N L L T K P H V A N V D caagtgattctcgtggtaacggtgaaaatgccggaaacttcgacctacataatcgataaa Q V I L V V T V K M P E T S T Y I I D K tttcttgttctcgctgaaaagaacgaactggaaacggtgatggtcatcaacaagatggac F L V L A E K N E L E T V M V I N K M D ctctacgatgaagacgatctgaggaaggtaagagagctggaagagatctattctggactc L Y D E D D L R K V R E L E E I Y S G L tatccaatcgtgaaaaccagtgcgaaaaccggaatgggaatcgaagagctcaaggaatat Y P I V K T S A K T G M G I E E L K E Y ctgaagggaaagatcagcacgatggccggactctccggagttggaaaaagtagcttgctc L K G K I S T M A G L S G V G K S S L L aacgccataaatcccggtttgaaattacgggtgagcgaagtttcagagaaactccaaagg N A I N P G L K L R V S E V S E K L Q R ggaaggcatactacaacaactgcccagctcttgaaattcgatttcggaggttacgtagtc G R H T T T T A Q L L K F D F G G Y V V gatactccgggtttcgcaaatctggagatcaacgacatagaacccgaggaactgaaacac D T P G F A N L E I N D I E P E E L K H tacttcaaggaatttggagacaaacagtgtttcttctcggactgcaaccacgtggatgaa Y F K E F G D K Q C F F S D C N H V D E ccggagtgtggagtgaaagaagccgtggagaacggagaaatcgcagaaagtcgatacgaa P E C G V K E A V E N G E I A E S R Y E aactacgtgaagatgttttacgagcttctgggaaggaggaaaaagtaa N Y V K M F Y E L L G R R K K *
MNLRRRGIVVSFHSNMVTVEDEETGERILCKLRGKFRLQNLKIYVGDRVEYTPDETGSGVIENVLHRKNLLTKPHVANVD QVILVVTVKMPETSTYIIDKFLVLAEKNELETVMVINKMDLYDEDDLRKVRELEEIYSGLYPIVKTSAKTGMGIEELKEY LKGKISTMAGLSGVGKSSLLNAINPGLKLRVSEVSEKLQRGRHTTTTAQLLKFDFGGYVVDTPGFANLEINDIEPEELKH YFKEFGDKQCFFSDCNHVDEPECGVKEAVENGEIAESRYENYVKMFYELLGRRKK
This information was obtained using the Protein Parameters tool on the ExPASy Molecular Biology Server.
Number of amino acids: 295
Molecular weight: 33641.6
Theoretical pI: 5.70
Amino acid composition:
Ala (A) 9 3.1%
Arg (R) 16 5.4%
Asn (N) 15 5.1%
Asp (D) 15 5.1%
Cys (C) 4 1.4%
Gln (Q) 5 1.7%
Glu (E) 33 11.2%
Gly (G) 22 7.5%
His (H) 6 2.0%
Ile (I) 16 5.4%
Leu (L) 30 10.2%
Lys (K) 26 8.8%
Met (M) 8 2.7%
Phe (F) 11 3.7%
Pro (P) 8 2.7%
Ser (S) 14 4.7%
Thr (T) 17 5.8%
Trp (W) 0 0.0%
Tyr (Y) 12 4.1%
Val (V) 28 9.5%
Asx (B) 0 0.0%
Glx (Z) 0 0.0%
Xaa (X) 0 0.0%
Total number of negatively charged residues (Asp + Glu): 48
Total number of positively charged residues (Arg + Lys): 42
Atomic composition:
Carbon C 1494
Hydrogen H 2397
Nitrogen N 401
Oxygen O 455
Sulfur S 12
Formula: C1494H2397N401O455S12
Total number of atoms: 4759
Extinction coefficients:
Conditions: 6.0 M guanidium hydrochloride
0.02 M phosphate buffer
pH 6.5
Extinction coefficients are in units of M-1 cm-1 .
The first table lists values computed assuming ALL Cys
residues appear as half cystines, whereas the second table
assumes that NONE do.
276 278 279 280 282
nm nm nm nm nm
Ext. coefficient 17690 17054 16380 15600 14640
Abs 0.1% (=1 g/l) 0.526 0.507 0.487 0.464 0.435
276 278 279 280 282
nm nm nm nm nm
Ext. coefficient 17400 16800 16140 15360 14400
Abs 0.1% (=1 g/l) 0.517 0.499 0.480 0.457 0.428
Estimated half-life:
The N-terminal of the sequence considered is M (Met).
The estimated half-life is: 30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Instability index:
The instability index (II) is computed to be 37.64
This classifies the protein as stable.
Aliphatic index: 91.39
Grand average of hydropathicity (GRAVY): -0.390