|
|
This gene has the annotation "MG260 homolog, from M. genitalium".
The target was selected as part of JMC's second set.
Available sections:
| Experiment | Result | User | Experiment Date |
|---|---|---|---|
| Selected | Done | jmc | 2002-02-25 |
| Cloned | Done | r_kim | 2003-05-12 |
| Expression tested | Done | r_kim | 2003-05-12 |
| Solubility tested | S | r_kim | 2003-05-12 |
| Purified | Done | r_kim | 2003-09-12 |
| MP gene | log10(PSIBLAST E) | % identical | % coverage (of MP gene) |
|---|---|---|---|
| MP002 / MPN152 | -55.10 | 54.27 | 98.80 |
| MP007 / MPN147 | -54.52 | 50.30 | 99.40 |
| MP056 / MPN098 | -9.00 | 78.57 | 16.87 |
| MP057 / MPN097 | -4.70 | 50.00 | 15.66 |
| MP336 / MPN506 | -55.70 | 55.76 | 99.40 |
| MP430 / MPN408 | -53.52 | 46.67 | 99.40 |
| MP472 / MPN364 | -54.10 | 56.02 | 100.00 |
| MP547 / MPN288 | -55.70 | 56.97 | 99.40 |
| MP551 / MPN284 | -55.52 | 55.49 | 98.80 |
| MP553 / MPN282 | -56.30 | 100.00 | 100.00 |
| MP631 / MPN200 | -53.70 | 55.15 | 99.40 |
| MP632 / MPN199 | -34.52 | 31.52 | 99.40 |
ATGAAGACTATTTACATTTACAAAGGCTCTATTCCTGAAGATAAAAAGAAAGGTGATAATGCCATTTGAGTTACTGAGAA AAAAATTATTGATGCTTTAGAAAAAGCTGCTAATTCTAATGGTGAAAGTACACAATCTAATCCAAAAACCATAGCACTTC AAGCAGCTAAAAAAGAAACTAAAAAGAGCAATAAGAAAGAATCAAAAACGATTGGATATACAACTACTGGTTATGTCAAT GCTGATGGTAAACATATTTTTGATACAGACAGAATTAACAATGAGAGGTTTGATCGTAAAATTATTATTGGTGCTACTCT AGAAACTTTAGACCAATCTAGTACACTCCAAAGTGGTGAAGCAATTGTCTTACCAGCACCTGGTAAATATAAGAGTAGTG ATCAAAAAACGGTTATGACAGCGCAAGGCCCCAAGATAATCGGGATCCATGCTAATGCTAAAGAGAACGAAGAAACACAA AAATTTGTTAATTGGTTTTAA
(167 codons) fields: [triplet] [frequency: per thousand] ([number]) UUU24.0( 4) UCU24.0( 4) UAU18.0( 3) UGU0.0( 0) UUC0.0( 0) UCC0.0( 0) UAC12.0( 2) UGC0.0( 0) UUA18.0( 3) UCA6.0( 1) UAA6.0( 1) UGA6.0( 1) UUG0.0( 0) UCG0.0( 0) UAG0.0( 0) UGG6.0( 1) CUU6.0( 1) CCU12.0( 2) CAU12.0( 2) CGU6.0( 1) CUC6.0( 1) CCC6.0( 1) CAC0.0( 0) CGC0.0( 0) CUA6.0( 1) CCA12.0( 2) CAA41.9( 7) CGA0.0( 0) CUG0.0( 0) CCG0.0( 0) CAG0.0( 0) CGG0.0( 0) AUU77.8( 13) ACU41.9( 7) AAU53.9( 9) AGU29.9( 5) AUC12.0( 2) ACC6.0( 1) AAC12.0( 2) AGC6.0( 1) AUA12.0( 2) ACA35.9( 6) AAA107.8( 18) AGA6.0( 1) AUG12.0( 2) ACG12.0( 2) AAG35.9( 6) AGG6.0( 1) GUU18.0( 3) GCU47.9( 8) GAU41.9( 7) GGU41.9( 7) GUC12.0( 2) GCC6.0( 1) GAC12.0( 2) GGC12.0( 2) GUA0.0( 0) GCA24.0( 4) GAA53.9( 9) GGA6.0( 1) GUG0.0( 0) GCG6.0( 1) GAG18.0( 3) GGG6.0( 1)
Details (problem DNA region is in upper case, with the key on the line below):
Key:
atgaagactatttacatttacaaaggctctattcctgaagataaaaagaaaggtgataat
gccattTGAgttactgagaaaaaaattattgatgctttagaaaaagctgctaattctaat
U
ggtgaaagtacacaatctaatccaaaaaccatagcacttcaagcagctaaaaaagaaact
aaaaagagcaataagaaagaatcaaaaacgattggatatacaactactggttatgtcaat
gctgatggtaaacatatttttgatacagacagaattaacaatgagaggtttgatcgtaaa
attattattggtgctactctagaaactttagaccaatctagtacactccaaagtggtgaa
gcaattgtcttaccagcacctggtaaatataagagtagTGATCAaaaaacggttatgaca
3
gcgcaaggccccaagataatcgGGATCCatgctaatgctaaagagaacgaagaaacacaa
2
aaatttgttaattggttttaa
Note: These were generated using Hisao's algorithm, and do not take into account possible mispriming, self-complementarity, or requirements for mutations anywhere in the sequences. The -R1 primers are for the N-terminal end, and begin with an NdeI restriction site (CATATG). The -R2 primers are for the C-terminal end, and begin with a BamHI site (GGATCC) if the target has no other BamHI sites. If the target does have a BamHI site, the -R2 primer wil begin with a BglII site (AGATCT), unless the target has no BglII sites. If the target has both sites, the design program gives up and doesn't prepend a restriction site to the -R2 primer!
Predicted Tm was obtained using the Tm determination tool at the Virtual Genome Center.
| Primer ID | Predicted Tm | sequence |
|---|---|---|
| 1262B-R1 | 60.40 | CATATGAAGACTATTTACATTTACAAAGGCTCT |
| 1262B-R2 | 60.40 | AGATCTTTAAAACCAATTAACAAATTTTTGTGTTT |
| 1262B-R10 | 64.70 | GGCGGTGGTGGCGGCATGAAGACTATTTACATTTACAAAGGCTCTATTCC |
| 1262B-R11 | 63.40 | GTTCTTCTCCTTTGCGCCCCTAAAACCAATTAACAAATTTTTGTGTTTCTTC |
| 1262B-R14 | 68.40 | TGATAATGCCATTTGGGTTACTGAGAAAAAA |
| 1262B-R15 | 68.40 | TTTTTTCTCAGTAACCCAAATGGCATTATCA |
Note: This was generated using the standard codon usage table; UGA codons in MP/MP genes will show up as terminators ("*")
atgaagactatttacatttacaaaggctctattcctgaagataaaaagaaaggtgataat M K T I Y I Y K G S I P E D K K K G D N gccatttgagttactgagaaaaaaattattgatgctttagaaaaagctgctaattctaat A I * V T E K K I I D A L E K A A N S N ggtgaaagtacacaatctaatccaaaaaccatagcacttcaagcagctaaaaaagaaact G E S T Q S N P K T I A L Q A A K K E T aaaaagagcaataagaaagaatcaaaaacgattggatatacaactactggttatgtcaat K K S N K K E S K T I G Y T T T G Y V N gctgatggtaaacatatttttgatacagacagaattaacaatgagaggtttgatcgtaaa A D G K H I F D T D R I N N E R F D R K attattattggtgctactctagaaactttagaccaatctagtacactccaaagtggtgaa I I I G A T L E T L D Q S S T L Q S G E gcaattgtcttaccagcacctggtaaatataagagtagtgatcaaaaaacggttatgaca A I V L P A P G K Y K S S D Q K T V M T gcgcaaggccccaagataatcgggatccatgctaatgctaaagagaacgaagaaacacaa A Q G P K I I G I H A N A K E N E E T Q aaatttgttaattggttttaa K F V N W F *
MKTIYIYKGSIPEDKKKGDNAIWVTEKKIIDALEKAANSNGESTQSNPKTIALQAAKKETKKSNKKESKTIGYTTTGYVN ADGKHIFDTDRINNERFDRKIIIGATLETLDQSSTLQSGEAIVLPAPGKYKSSDQKTVMTAQGPKIIGIHANAKENEETQ KFVNWF
This information was obtained using the Protein Parameters tool on the ExPASy Molecular Biology Server.
Number of amino acids: 166
Molecular weight: 18395.8
Theoretical pI: 9.32
Amino acid composition:
Ala (A) 14 8.4%
Arg (R) 3 1.8%
Asn (N) 11 6.6%
Asp (D) 9 5.4%
Cys (C) 0 0.0%
Gln (Q) 7 4.2%
Glu (E) 12 7.2%
Gly (G) 11 6.6%
His (H) 2 1.2%
Ile (I) 17 10.2%
Leu (L) 6 3.6%
Lys (K) 24 14.5%
Met (M) 2 1.2%
Phe (F) 4 2.4%
Pro (P) 5 3.0%
Ser (S) 11 6.6%
Thr (T) 16 9.6%
Trp (W) 2 1.2%
Tyr (Y) 5 3.0%
Val (V) 5 3.0%
Asx (B) 0 0.0%
Glx (Z) 0 0.0%
Xaa (X) 0 0.0%
Total number of negatively charged residues (Asp + Glu): 21
Total number of positively charged residues (Arg + Lys): 27
Atomic composition:
Carbon C 811
Hydrogen H 1313
Nitrogen N 223
Oxygen O 259
Sulfur S 2
Formula: C811H1313N223O259S2
Total number of atoms: 2608
Extinction coefficients:
Conditions: 6.0 M guanidium hydrochloride
0.02 M phosphate buffer
pH 6.5
Extinction coefficients are in units of M-1 cm-1 .
276 278 279 280 282
nm nm nm nm nm
Ext. coefficient 18050 18200 18045 17780 17200
Abs 0.1% (=1 g/l) 0.981 0.989 0.981 0.967 0.935
Estimated half-life:
The N-terminal of the sequence considered is M (Met).
The estimated half-life is: 30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Instability index:
The instability index (II) is computed to be 26.68
This classifies the protein as stable.
Aliphatic index: 71.20
Grand average of hydropathicity (GRAVY): -0.784