Berkeley Structural Genomics Center

Target info for 1292B

This target is gi number 15806048 from Deinococcus radiodurans.

This gene has the annotation "MutT/nudix family protein".

The target was selected as part of Collaborators' targets.

Available sections:


Experimental status of 1292B

Note: Dates prior to 10/24/01 may be inaccurate, due to conversion from a record-keeping system which tracked only the last experimental date, to a new system which keeps track of all dates. The user is the person who entered the data, not the person who did the experiment. This will also change in the future.

ExperimentResultUserExperiment Date
SelectedDonesrholbrook2002-11-01
ClonedDonesrholbrook2002-11-04
Expression testedDonesrholbrook2002-11-04
Solubility testedSsrholbrook2002-11-04
PurifiedDonesrholbrook2002-11-04
CrystallizedDonesrholbrook2002-11-04
Diffraction quality crystalsDonesrholbrook2002-11-04
Phasing diffraction dataDonesrholbrook2002-11-04
Traceable mapDonesrholbrook2002-11-04
Crystal structureDonedhshin2004-04-23
In PDB1SJY 1SOI 1SU2 1SZ3dhshin2004-04-23

Back to Top


Potential MP Homologues of 1292B

No MP homologues identified for this gene.

Back to Top


1292B DNA sequence

GTGGAGCACGACGAGCGAACCCACGTTCCGGTGGAGCTGAGGGCCGCCGGGGTCGTCCTGCTGAATGAGCGGGGCGACAT
CCTGCTGGTGCAGGAAAAAGGAATTCCTGGTCACCCGGAAAAGGCCGGGTTGTGGCACATCCCCTCCGGCGCCGTCGAGG
ACGGTGAAAATCCGCAGGACGCCGCGGTGCGCGAGGCCTGCGAGGAAACCGGCCTGCGCGTGCGCCCCGTCAAGTTCCTG
GGCGCTTACCTGGGCCGCTTCCCCGACGGCGTGCTGATTTTGCGCCACGTCTGGTTGGCCGAGCCGGAGCCGGGACAGAC
GCTCGCCCCTGCTTTCACTGATGAAATAGCCGAGGCCAGCTTCGTCAGCCGCGAGGACTTTGCCCAGTTATATGCGGCGG
GCCAGATTCGCATGTATCAGACCAAACTGTTTTACGCCGACGCCTTACGGGAAAAGGGCTTTCCCGCCCTCCCTGTTTAA

Back to Top


1292B Codon Usage

(160 codons)
fields: [triplet] [frequency: per thousand] ([number])

UUU18.8(   3)  UCU0.0(   0)  UAU12.5(   2)  UGU0.0(   0)  
UUC25.0(   4)  UCC6.2(   1)  UAC12.5(   2)  UGC6.2(   1)  
UUA12.5(   2)  UCA0.0(   0)  UAA6.2(   1)  UGA0.0(   0)  
UUG18.8(   3)  UCG0.0(   0)  UAG0.0(   0)  UGG12.5(   2)  

CUU0.0(   0)  CCU18.8(   3)  CAU0.0(   0)  CGU0.0(   0)  
CUC12.5(   2)  CCC25.0(   4)  CAC31.2(   5)  CGC43.8(   7)  
CUA0.0(   0)  CCA0.0(   0)  CAA0.0(   0)  CGA6.2(   1)  
CUG62.5(  10)  CCG31.2(   5)  CAG37.5(   6)  CGG12.5(   2)  

AUU18.8(   3)  ACU6.2(   1)  AAU12.5(   2)  AGU0.0(   0)  
AUC12.5(   2)  ACC18.8(   3)  AAC0.0(   0)  AGC12.5(   2)  
AUA6.2(   1)  ACA0.0(   0)  AAA12.5(   2)  AGA0.0(   0)  
AUG6.2(   1)  ACG6.2(   1)  AAG18.8(   3)  AGG6.2(   1)  

GUU12.5(   2)  GCU12.5(   2)  GAU6.2(   1)  GGU12.5(   2)  
GUC37.5(   6)  GCC87.5(  14)  GAC43.8(   7)  GGC50.0(   8)  
GUA0.0(   0)  GCA0.0(   0)  GAA37.5(   6)  GGA12.5(   2)  
GUG37.5(   6)  GCG18.8(   3)  GAG68.8(  11)  GGG12.5(   2)  

Back to Top


1292B Potential Cloning Problems

No UGA codons or (bad) restriction sites!

Back to Top


1292B Automatically Selected Primers

Note: These were generated using Hisao's algorithm, and do not take into account possible mispriming, self-complementarity, or requirements for mutations anywhere in the sequences. The -R1 primers are for the N-terminal end, and begin with an NdeI restriction site (CATATG). The -R2 primers are for the C-terminal end, and begin with a BamHI site (GGATCC) if the target has no other BamHI sites. If the target does have a BamHI site, the -R2 primer wil begin with a BglII site (AGATCT), unless the target has no BglII sites. If the target has both sites, the design program gives up and doesn't prepend a restriction site to the -R2 primer!

Predicted Tm was obtained using the Tm determination tool at the Virtual Genome Center.

Primer IDPredicted Tmsequence
1292B-R161.80CATATGGAGCACGACGAGCG
1292B-R263.10GGATCCTTAAACAGGGAGGGCGGG
1292B-R1064.10GGCGGTGGTGGCGGCATGGAGCACGACGAGCGA
1292B-R1163.70GTTCTTCTCCTTTGCGCCCCTAAACAGGGAGGGCGGGA

Back to Top


1292B Translation

Note: This was generated using the standard codon usage table; UGA codons in MP/MP genes will show up as terminators ("*")

gtggagcacgacgagcgaacccacgttccggtggagctgagggccgccggggtcgtcctg
 V  E  H  D  E  R  T  H  V  P  V  E  L  R  A  A  G  V  V  L 
ctgaatgagcggggcgacatcctgctggtgcaggaaaaaggaattcctggtcacccggaa
 L  N  E  R  G  D  I  L  L  V  Q  E  K  G  I  P  G  H  P  E 
aaggccgggttgtggcacatcccctccggcgccgtcgaggacggtgaaaatccgcaggac
 K  A  G  L  W  H  I  P  S  G  A  V  E  D  G  E  N  P  Q  D 
gccgcggtgcgcgaggcctgcgaggaaaccggcctgcgcgtgcgccccgtcaagttcctg
 A  A  V  R  E  A  C  E  E  T  G  L  R  V  R  P  V  K  F  L 
ggcgcttacctgggccgcttccccgacggcgtgctgattttgcgccacgtctggttggcc
 G  A  Y  L  G  R  F  P  D  G  V  L  I  L  R  H  V  W  L  A 
gagccggagccgggacagacgctcgcccctgctttcactgatgaaatagccgaggccagc
 E  P  E  P  G  Q  T  L  A  P  A  F  T  D  E  I  A  E  A  S 
ttcgtcagccgcgaggactttgcccagttatatgcggcgggccagattcgcatgtatcag
 F  V  S  R  E  D  F  A  Q  L  Y  A  A  G  Q  I  R  M  Y  Q 
accaaactgttttacgccgacgccttacgggaaaagggctttcccgccctccctgtttaa
 T  K  L  F  Y  A  D  A  L  R  E  K  G  F  P  A  L  P  V  * 

Back to Top


1292B AA Sequence

MEHDERTHVPVELRAAGVVLLNERGDILLVQEKGIPGHPEKAGLWHIPSGAVEDGENPQDAAVREACEETGLRVRPVKFL
GAYLGRFPDGVLILRHVWLAEPEPGQTLAPAFTDEIAEASFVSREDFAQLYAAGQIRMYQTKLFYADALREKGFPALPV

Back to Top


1292B Protein Parameters

This information was obtained using the Protein Parameters tool on the ExPASy Molecular Biology Server.

Number of amino acids: 159

Molecular weight: 17568.9

Theoretical pI: 5.01

Amino acid composition:

Ala (A)  19	 11.9%
Arg (R)  11	  6.9%
Asn (N)   2	  1.3%
Asp (D)   8	  5.0%
Cys (C)   1	  0.6%
Gln (Q)   6	  3.8%
Glu (E)  17	 10.7%
Gly (G)  14	  8.8%
His (H)   5	  3.1%
Ile (I)   6	  3.8%
Leu (L)  17	 10.7%
Lys (K)   5	  3.1%
Met (M)   2	  1.3%
Phe (F)   7	  4.4%
Pro (P)  12	  7.5%
Ser (S)   3	  1.9%
Thr (T)   5	  3.1%
Trp (W)   2	  1.3%
Tyr (Y)   4	  2.5%
Val (V)  13	  8.2%

Asx (B)   0	  0.0%
Glx (Z)   0	  0.0%
Xaa (X)   0	  0.0%

Total number of negatively charged residues (Asp + Glu): 25
Total number of positively charged residues (Arg + Lys): 16

Atomic composition:

Carbon      C	       792
Hydrogen    H	      1231
Nitrogen    N	       217
Oxygen      O	       230
Sulfur      S	         3

Formula: C792H1231N217O230S3
Total number of atoms: 2473

Extinction coefficients:

Conditions: 6.0 M guanidium hydrochloride
            0.02 M phosphate buffer
            pH 6.5

Extinction coefficients are in units of  M-1 cm-1 .

The first table lists values computed assuming ALL Cys 
residues appear as half cystines, whereas the second table 
assumes that NONE do. 

                      276     278     279     280     282
                       nm      nm      nm      nm      nm
Ext. coefficient    16600   16800   16700   16500   16000
Abs 0.1% (=1 g/l)   0.945   0.956   0.951   0.939   0.911



                      276     278     279     280     282
                       nm      nm      nm      nm      nm
Ext. coefficient    16600   16800   16700   16500   16000
Abs 0.1% (=1 g/l)   0.945   0.956   0.951   0.939   0.911


Estimated half-life:

The N-terminal of the sequence considered is M (Met).

The estimated half-life is: 30 hours (mammalian reticulocytes, in vitro).
                            >20 hours (yeast, in vivo).
                            >10 hours (Escherichia coli, in vivo).


Instability index:

The instability index (II) is computed to be 56.28
This classifies the protein as unstable.



Aliphatic index: 92.08

Grand average of hydropathicity (GRAVY): -0.201

Back to Top