|
|
This gene has the annotation "osmotically inducible protein".
The target was selected as part of Igor's sets.
Available sections:
| Experiment | Result | User | Experiment Date |
|---|---|---|---|
| Selected | Done | jmc | 2001-08-24 |
| Cloned | Done | abwaight | 2001-08-24 |
| Expression tested | Done | abwaight | 2001-08-24 |
| Solubility tested | S | abwaight | 2001-08-24 |
| Purified | Done | r_kim | 2001-11-29 |
| Crystallized | Done | weiru | 2002-05-08 |
| Diffraction quality crystals | Done | weiru | 2002-05-08 |
| Native diffraction data | Done | dhshin | 2003-01-15 |
| Phasing diffraction data | Done | dhshin | 2003-01-15 |
| Traceable map | Done | dhshin | 2003-01-15 |
| Crystal structure | Done | dhshin | 2003-01-15 |
| In PDB | 1NYE | dhshin | 2003-02-12 |
| Suggested work stop | 13805 13805 13805 15565 15565 15794 | jmc | 2002-10-07 |
| MP gene | log10(PSIBLAST E) | % identical | % coverage (of MP gene) |
|---|---|---|---|
| MP174 / MPN668 | -22.40 | 27.46 | 99.30 |
| MP217 / MPN625 | -19.52 | 17.61 | 99.30 |
ATGACAATCCATAAGAAAGGTCAGGCACACTGGGAAGGCGATATCAAACGCGGGAAGGGAACAGTATCCACCGAGAGTGG CGTGCTGAACCAACAGCCGTATGGATTTAACACGCGTTTTGAAGGCGAAAAAGGAACCAACCCTGAAGAACTGATTGGCG CAGCGCATGCCGCATGTTTCTCAATGGCGCTTTCATTAATGCTGGGGGAAGCGGGATTCACGCCAACATCGATTGATACC ACCGCCGATGTGTCGCTGGATAAAGTGGATGCCGGTTTTGCGATTACGAAAATCGCACTGAAGAGTGAAGTTGCGGTGCC GGGTATTGATGCCTCTACCTTTGACGGCATAATCCAGAAAGCAAAAGCAGGATGCCCGGTCTCTCAGGTACTGAAAGCGG AAATTACGCTGGATTACCAGTTGAAATCGTAA
(144 codons) fields: [triplet] [frequency: per thousand] ([number]) UUU27.8( 4) UCU13.9( 2) UAU6.9( 1) UGU6.9( 1) UUC13.9( 2) UCC6.9( 1) UAC6.9( 1) UGC6.9( 1) UUA6.9( 1) UCA13.9( 2) UAA6.9( 1) UGA0.0( 0) UUG6.9( 1) UCG20.8( 3) UAG0.0( 0) UGG6.9( 1) CUU6.9( 1) CCU6.9( 1) CAU13.9( 2) CGU6.9( 1) CUC0.0( 0) CCC0.0( 0) CAC6.9( 1) CGC6.9( 1) CUA0.0( 0) CCA6.9( 1) CAA6.9( 1) CGA0.0( 0) CUG48.6( 7) CCG20.8( 3) CAG34.7( 5) CGG0.0( 0) AUU34.7( 5) ACU0.0( 0) AAU0.0( 0) AGU13.9( 2) AUC27.8( 4) ACC34.7( 5) AAC20.8( 3) AGC0.0( 0) AUA6.9( 1) ACA20.8( 3) AAA62.5( 9) AGA0.0( 0) AUG20.8( 3) ACG27.8( 4) AAG20.8( 3) AGG0.0( 0) GUU6.9( 1) GCU0.0( 0) GAU48.6( 7) GGU20.8( 3) GUC6.9( 1) GCC27.8( 4) GAC6.9( 1) GGC34.7( 5) GUA13.9( 2) GCA41.7( 6) GAA55.6( 8) GGA34.7( 5) GUG27.8( 4) GCG41.7( 6) GAG6.9( 1) GGG13.9( 2)
Note: These were generated using Hisao's algorithm, and do not take into account possible mispriming, self-complementarity, or requirements for mutations anywhere in the sequences. The -R1 primers are for the N-terminal end, and begin with an NdeI restriction site (CATATG). The -R2 primers are for the C-terminal end, and begin with a BamHI site (GGATCC) if the target has no other BamHI sites. If the target does have a BamHI site, the -R2 primer wil begin with a BglII site (AGATCT), unless the target has no BglII sites. If the target has both sites, the design program gives up and doesn't prepend a restriction site to the -R2 primer!
Predicted Tm was obtained using the Tm determination tool at the Virtual Genome Center.
| Primer ID | Predicted Tm | sequence |
|---|---|---|
| 1029B-R1 | 61.60 | CATATGACAATCCATAAGAAAGGTCAGG |
| 1029B-R2 | 62.50 | GGATCCTTACGATTTCAACTGGTAATCCAGC |
| 1029B-R10 | 64.60 | GGCGGTGGTGGCGGCATGACAATCCATAAGAAAGGTCAGGC |
| 1029B-R11 | 65.30 | GTTCTTCTCCTTTGCGCCCCTACGATTTCAACTGGTAATCCAGCG |
Note: This was generated using the standard codon usage table; UGA codons in MP/MP genes will show up as terminators ("*")
atgacaatccataagaaaggtcaggcacactgggaaggcgatatcaaacgcgggaaggga M T I H K K G Q A H W E G D I K R G K G acagtatccaccgagagtggcgtgctgaaccaacagccgtatggatttaacacgcgtttt T V S T E S G V L N Q Q P Y G F N T R F gaaggcgaaaaaggaaccaaccctgaagaactgattggcgcagcgcatgccgcatgtttc E G E K G T N P E E L I G A A H A A C F tcaatggcgctttcattaatgctgggggaagcgggattcacgccaacatcgattgatacc S M A L S L M L G E A G F T P T S I D T accgccgatgtgtcgctggataaagtggatgccggttttgcgattacgaaaatcgcactg T A D V S L D K V D A G F A I T K I A L aagagtgaagttgcggtgccgggtattgatgcctctacctttgacggcataatccagaaa K S E V A V P G I D A S T F D G I I Q K gcaaaagcaggatgcccggtctctcaggtactgaaagcggaaattacgctggattaccag A K A G C P V S Q V L K A E I T L D Y Q ttgaaatcgtaa L K S *
MTIHKKGQAHWEGDIKRGKGTVSTESGVLNQQPYGFNTRFEGEKGTNPEELIGAAHAACFSMALSLMLGEAGFTPTSIDT TADVSLDKVDAGFAITKIALKSEVAVPGIDASTFDGIIQKAKAGCPVSQVLKAEITLDYQLKS
This information was obtained using the Protein Parameters tool on the ExPASy Molecular Biology Server.
Number of amino acids: 143
Molecular weight: 15088.1
Theoretical pI: 5.57
Amino acid composition:
Ala (A) 16 11.2%
Arg (R) 2 1.4%
Asn (N) 3 2.1%
Asp (D) 8 5.6%
Cys (C) 2 1.4%
Gln (Q) 6 4.2%
Glu (E) 9 6.3%
Gly (G) 15 10.5%
His (H) 3 2.1%
Ile (I) 10 7.0%
Leu (L) 10 7.0%
Lys (K) 12 8.4%
Met (M) 3 2.1%
Phe (F) 6 4.2%
Pro (P) 5 3.5%
Ser (S) 10 7.0%
Thr (T) 12 8.4%
Trp (W) 1 0.7%
Tyr (Y) 2 1.4%
Val (V) 8 5.6%
Asx (B) 0 0.0%
Glx (Z) 0 0.0%
Xaa (X) 0 0.0%
Total number of negatively charged residues (Asp + Glu): 17
Total number of positively charged residues (Arg + Lys): 14
Atomic composition:
Carbon C 666
Hydrogen H 1065
Nitrogen N 177
Oxygen O 211
Sulfur S 5
Formula: C666H1065N177O211S5
Total number of atoms: 2124
Extinction coefficients:
Conditions: 6.0 M guanidium hydrochloride
0.02 M phosphate buffer
pH 6.5
Extinction coefficients are in units of M-1 cm-1 .
The first table lists values computed assuming ALL Cys
residues appear as half cystines, whereas the second table
assumes that NONE do.
276 278 279 280 282
nm nm nm nm nm
Ext. coefficient 8445 8527 8470 8370 8120
Abs 0.1% (=1 g/l) 0.560 0.565 0.561 0.555 0.538
276 278 279 280 282
nm nm nm nm nm
Ext. coefficient 8300 8400 8350 8250 8000
Abs 0.1% (=1 g/l) 0.550 0.557 0.553 0.547 0.530
Estimated half-life:
The N-terminal of the sequence considered is M (Met).
The estimated half-life is: 30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Instability index:
The instability index (II) is computed to be 18.43
This classifies the protein as stable.
Aliphatic index: 81.96
Grand average of hydropathicity (GRAVY): -0.122