Berkeley Structural Genomics Center

Target info for 1316B

This target is gi number 15644479 from Thermotoga maritima.

This gene has the annotation "conserved hypothetical protein".

The target was selected as part of JMC's third set.

Available sections:


Experimental status of 1316B

Note: Dates prior to 10/24/01 may be inaccurate, due to conversion from a record-keeping system which tracked only the last experimental date, to a new system which keeps track of all dates. The user is the person who entered the data, not the person who did the experiment. This will also change in the future.

ExperimentResultUserExperiment Date
SelectedDonejmc2002-11-07
ClonedDoner_kim2003-02-11
Expression testedDoner_kim2003-02-11
Solubility testedSr_kim2003-02-11
PurifiedDonedhshin2003-09-12
CrystallizedDonedhshin2003-09-12
Diffraction quality crystalsDonedhshin2004-01-27
Native diffraction dataDonedhshin2004-01-27
Phasing diffraction dataDonedhshin2004-01-27
Traceable mapDonedhshin2004-02-13
Crystal structureDonedhshin2004-10-04
In PDB1YT5dhshin2005-02-10
Suggested work stop9402 9402 9402 11558 11558 11558 11834 11834 11834 11834 12057 12057 12057 12057 13225 13225 16927 16927 16927 16927 24001 24001dallen2004-02-10
Override suggest work stopTraceable map obtaineddhshin2004-02-13

Back to Top


Potential MP Homologues of 1316B

MP genelog10(PSIBLAST E)% identical% coverage (of MP gene)
MP566 / MPN267-47.2221.1297.29

Back to Top


1316B DNA sequence

ATGAAAATCGCCATTCTCTACAGAGAAGAGCGGGAAAAAGAGGGAGAGTTCTTGAAAGAAAAGATTTCAAAAGAACACGA
AGTAATCGAGTTCGGTGAAGCGAACGCTCCAGGAAGGGTTACGGCAGATTTGATAGTGGTGGTTGGAGGAGACGGAACCG
TGCTCAAGGCAGCGAAAAAAGCGGCCGATGGAACACCGATGGTGGGCTTCAAGGCAGGCAGACTGGGGTTCCTCACATCC
TACACCCTCGATGAGATAGATCGATTTCTCGAGGATCTCAGAAACTGGAACTTCCGGGAAGAAACAAGATGGTTCATACA
GATCGAAAGTGAACTCGGAAACCATCTCGCCCTGAACGATGTCACCCTCGAACGTGACCTGAGTGGAAAGATGGTCGAAA
TAGAGGTCGAGGTGGAGCACCACTCTTCCATGTGGTTCTTCGCAGACGGAGTGGTGATTTCCACACCGACAGGTTCCACG
GCTTATTCTCTTTCCATAGGAGGTCCCATAATATTCCCGGAATGCGAGGTGCTGGAGATCTCTCCCATTGCACCACAATT
CTTTCTCACCCGAAGCGTTGTGATACCCTCGAATTTCAAAGTGGTGGTTGAATCCCAGAGAGATATAAACATGCTGGTGG
ATGGAGTCCTGACGGGAAAAACAAAACGAATCGAAGTAAAGAAATCCAGAAGATACGTTAGAATTCTGAGACCTCCTGAG
TACGATTACGTGACGGTGATAAGAGACAAACTCGGTTACGGGAGGCGTATCGAGTGA

Back to Top


1316B Codon Usage

(259 codons)
fields: [triplet] [frequency: per thousand] ([number])

UUU7.7(   2)  UCU11.6(   3)  UAU3.9(   1)  UGU0.0(   0)  
UUC42.5(  11)  UCC27.0(   7)  UAC23.2(   6)  UGC3.9(   1)  
UUA0.0(   0)  UCA3.9(   1)  UAA0.0(   0)  UGA3.9(   1)  
UUG7.7(   2)  UCG3.9(   1)  UAG0.0(   0)  UGG11.6(   3)  

CUU3.9(   1)  CCU7.7(   2)  CAU3.9(   1)  CGU7.7(   2)  
CUC42.5(  11)  CCC11.6(   3)  CAC11.6(   3)  CGC0.0(   0)  
CUA0.0(   0)  CCA7.7(   2)  CAA3.9(   1)  CGA11.6(   3)  
CUG27.0(   7)  CCG11.6(   3)  CAG7.7(   2)  CGG7.7(   2)  

AUU19.3(   5)  ACU0.0(   0)  AAU3.9(   1)  AGU7.7(   2)  
AUC23.2(   6)  ACC15.4(   4)  AAC23.2(   6)  AGC3.9(   1)  
AUA38.6(  10)  ACA23.2(   6)  AAA42.5(  11)  AGA38.6(  10)  
AUG19.3(   5)  ACG15.4(   4)  AAG19.3(   5)  AGG7.7(   2)  

GUU19.3(   5)  GCU7.7(   2)  GAU34.7(   9)  GGU15.4(   4)  
GUC15.4(   4)  GCC11.6(   3)  GAC15.4(   4)  GGC7.7(   2)  
GUA7.7(   2)  GCA19.3(   5)  GAA57.9(  15)  GGA46.3(  12)  
GUG54.1(  14)  GCG11.6(   3)  GAG50.2(  13)  GGG7.7(   2)  

Back to Top


1316B Potential Cloning Problems

No UGA codons.
1 restriction site(s) found.

Details (problem DNA region is in upper case, with the key on the line below):

Key:

atgaaaatcgccattctctacagagaagagcgggaaaaagagggagagttcttgaaagaa
                                                            
aagatttcaaaagaacacgaagtaatcgagttcggtgaagcgaacgctccaggaagggtt
                                                            
acggcagatttgatagtggtggttggaggagacggaaccgtgctcaaggcagcgaaaaaa
                                                            
gcggccgatggaacaccgatggtgggcttcaaggcaggcagactggggttcctcacatcc
                                                            
tacaccctcgatgagatagatcgatttctcgaggatctcagaaactggaacttccgggaa
                                                            
gaaacaagatggttcatacagatcgaaagtgaactcggaaaccatctcgccctgaacgat
                                                            
gtcaccctcgaacgtgacctgagtggaaagatggtcgaaatagaggtcgaggtggagcac
                                                            
cactcttccatgtggttcttcgcagacggagtggtgatttccacaccgacaggttccacg
                                                            
gcttattctctttccataggaggtcccataatattcccggaatgcgaggtgctggAGATC
                                                       4    
Tctcccattgcaccacaattctttctcacccgaagcgttgtgataccctcgaatttcaaa
                                                            
gtggtggttgaatcccagagagatataaacatgctggtggatggagtcctgacgggaaaa
                                                            
acaaaacgaatcgaagtaaagaaatccagaagatacgttagaattctgagacctcctgag
                                                            
tacgattacgtgacggtgataagagacaaactcggttacgggaggcgtatcgagtga
                                                         

Back to Top


1316B Automatically Selected Primers

Note: These were generated using Hisao's algorithm, and do not take into account possible mispriming, self-complementarity, or requirements for mutations anywhere in the sequences. The -R1 primers are for the N-terminal end, and begin with an NdeI restriction site (CATATG). The -R2 primers are for the C-terminal end, and begin with a BamHI site (GGATCC) if the target has no other BamHI sites. If the target does have a BamHI site, the -R2 primer wil begin with a BglII site (AGATCT), unless the target has no BglII sites. If the target has both sites, the design program gives up and doesn't prepend a restriction site to the -R2 primer!

Predicted Tm was obtained using the Tm determination tool at the Virtual Genome Center.

Primer IDPredicted Tmsequence
1316B-R161.20CATATGAAAATCGCCATTCTCTACAGA
1316B-R260.40GGATCCTTACTCGATACGCCTCCCGT
1316B-R1063.50GGCGGTGGTGGCGGCATGAAAATCGCCATTCTCTACAGAGA
1316B-R1165.60GTTCTTCTCCTTTGCGCCCCTACTCGATACGCCTCCCGTAACC

Back to Top


1316B Translation

Note: This was generated using the standard codon usage table; UGA codons in MP/MP genes will show up as terminators ("*")

atgaaaatcgccattctctacagagaagagcgggaaaaagagggagagttcttgaaagaa
 M  K  I  A  I  L  Y  R  E  E  R  E  K  E  G  E  F  L  K  E 
aagatttcaaaagaacacgaagtaatcgagttcggtgaagcgaacgctccaggaagggtt
 K  I  S  K  E  H  E  V  I  E  F  G  E  A  N  A  P  G  R  V 
acggcagatttgatagtggtggttggaggagacggaaccgtgctcaaggcagcgaaaaaa
 T  A  D  L  I  V  V  V  G  G  D  G  T  V  L  K  A  A  K  K 
gcggccgatggaacaccgatggtgggcttcaaggcaggcagactggggttcctcacatcc
 A  A  D  G  T  P  M  V  G  F  K  A  G  R  L  G  F  L  T  S 
tacaccctcgatgagatagatcgatttctcgaggatctcagaaactggaacttccgggaa
 Y  T  L  D  E  I  D  R  F  L  E  D  L  R  N  W  N  F  R  E 
gaaacaagatggttcatacagatcgaaagtgaactcggaaaccatctcgccctgaacgat
 E  T  R  W  F  I  Q  I  E  S  E  L  G  N  H  L  A  L  N  D 
gtcaccctcgaacgtgacctgagtggaaagatggtcgaaatagaggtcgaggtggagcac
 V  T  L  E  R  D  L  S  G  K  M  V  E  I  E  V  E  V  E  H 
cactcttccatgtggttcttcgcagacggagtggtgatttccacaccgacaggttccacg
 H  S  S  M  W  F  F  A  D  G  V  V  I  S  T  P  T  G  S  T 
gcttattctctttccataggaggtcccataatattcccggaatgcgaggtgctggagatc
 A  Y  S  L  S  I  G  G  P  I  I  F  P  E  C  E  V  L  E  I 
tctcccattgcaccacaattctttctcacccgaagcgttgtgataccctcgaatttcaaa
 S  P  I  A  P  Q  F  F  L  T  R  S  V  V  I  P  S  N  F  K 
gtggtggttgaatcccagagagatataaacatgctggtggatggagtcctgacgggaaaa
 V  V  V  E  S  Q  R  D  I  N  M  L  V  D  G  V  L  T  G  K 
acaaaacgaatcgaagtaaagaaatccagaagatacgttagaattctgagacctcctgag
 T  K  R  I  E  V  K  K  S  R  R  Y  V  R  I  L  R  P  P  E 
tacgattacgtgacggtgataagagacaaactcggttacgggaggcgtatcgagtga
 Y  D  Y  V  T  V  I  R  D  K  L  G  Y  G  R  R  I  E  * 

Back to Top


1316B AA Sequence

MKIAILYREEREKEGEFLKEKISKEHEVIEFGEANAPGRVTADLIVVVGGDGTVLKAAKKAADGTPMVGFKAGRLGFLTS
YTLDEIDRFLEDLRNWNFREETRWFIQIESELGNHLALNDVTLERDLSGKMVEIEVEVEHHSSMWFFADGVVISTPTGST
AYSLSIGGPIIFPECEVLEISPIAPQFFLTRSVVIPSNFKVVVESQRDINMLVDGVLTGKTKRIEVKKSRRYVRILRPPE
YDYVTVIRDKLGYGRRIE

Back to Top


1316B Protein Parameters

This information was obtained using the Protein Parameters tool on the ExPASy Molecular Biology Server.

Number of amino acids: 258

Molecular weight: 29241.5

Theoretical pI: 5.48

Amino acid composition:

Ala (A)  13	  5.0%
Arg (R)  19	  7.4%
Asn (N)   7	  2.7%
Asp (D)  13	  5.0%
Cys (C)   1	  0.4%
Gln (Q)   3	  1.2%
Glu (E)  28	 10.9%
Gly (G)  20	  7.8%
His (H)   4	  1.6%
Ile (I)  21	  8.1%
Leu (L)  21	  8.1%
Lys (K)  16	  6.2%
Met (M)   5	  1.9%
Phe (F)  13	  5.0%
Pro (P)  10	  3.9%
Ser (S)  15	  5.8%
Thr (T)  14	  5.4%
Trp (W)   3	  1.2%
Tyr (Y)   7	  2.7%
Val (V)  25	  9.7%

Asx (B)   0	  0.0%
Glx (Z)   0	  0.0%
Xaa (X)   0	  0.0%

Total number of negatively charged residues (Asp + Glu): 41
Total number of positively charged residues (Arg + Lys): 35

Atomic composition:

Carbon      C	      1317
Hydrogen    H	      2092
Nitrogen    N	       352
Oxygen      O	       387
Sulfur      S	         6

Formula: C1317H2092N352O387S6
Total number of atoms: 4154

Extinction coefficients:

Conditions: 6.0 M guanidium hydrochloride
            0.02 M phosphate buffer
            pH 6.5

Extinction coefficients are in units of  M-1 cm-1 .

The first table lists values computed assuming ALL Cys 
residues appear as half cystines, whereas the second table 
assumes that NONE do. 

                      276     278     279     280     282
                       nm      nm      nm      nm      nm
Ext. coefficient    26350   26600   26395   26030   25200
Abs 0.1% (=1 g/l)   0.901   0.910   0.903   0.890   0.862



                      276     278     279     280     282
                       nm      nm      nm      nm      nm
Ext. coefficient    26350   26600   26395   26030   25200
Abs 0.1% (=1 g/l)   0.901   0.910   0.903   0.890   0.862


Estimated half-life:

The N-terminal of the sequence considered is M (Met).

The estimated half-life is: 30 hours (mammalian reticulocytes, in vitro).
                            >20 hours (yeast, in vivo).
                            >10 hours (Escherichia coli, in vivo).


Instability index:

The instability index (II) is computed to be 40.07
This classifies the protein as unstable.



Aliphatic index: 96.63

Grand average of hydropathicity (GRAVY): -0.177

Back to Top