Berkeley Structural Genomics Center

Target info for 1323B

This target is gi number 15674463 from Streptococcus pyogenes.

This gene has the annotation "similar to NifU protein".

The target was selected as part of JMC's third set.

Available sections:


Experimental status of 1323B

Note: Dates prior to 10/24/01 may be inaccurate, due to conversion from a record-keeping system which tracked only the last experimental date, to a new system which keeps track of all dates. The user is the person who entered the data, not the person who did the experiment. This will also change in the future.

ExperimentResultUserExperiment Date
SelectedDonejmc2002-11-07
ClonedDoner_kim2003-02-11
Expression testedDoner_kim2003-02-11
Solubility testedSr_kim2003-02-11
PurifiedDonedhshin2003-05-28
CrystallizedDonedhshin2003-05-28
Diffraction quality crystalsDonedhshin2003-05-28
Native diffraction dataDonedhshin2003-05-28
Phasing diffraction dataDonedhshin2003-07-07
Traceable mapDonedhshin2003-07-07
Crystal structureDonedhshin2003-08-29
In PDB1SU0dhshin2004-03-26

Back to Top


Potential MP Homologues of 1323B

MP genelog10(PSIBLAST E)% identical% coverage (of MP gene)
MP354 / MPN488-19.2222.6386.16

Back to Top


1323B DNA sequence

ATGGCACTCTCTAAACTGAACCATCTATACATGGCTGTGGTAGCGGACCATTCGAAACGTCCACATCATCATGGGCAACT
AGATGGCGTAGAGGCTGTTCAACTGAATAATCCGACTTGTGGTGATGTGATTTCTTTGACCGTTAAGTTTGACGAAGATA
AAATTGAAGATATTGCTTTTGCAGGCAACGGCTGTACCATTTCCACAGCTTCATCAAGCATGATGACAGATGCTGTTATT
GGTAAAAGTAAAGAAGAAGCACTCGCGTTAGCTGATATTTTTTCAGAGATGGTACAAGGACAGGAAAATCCTGCTCAAAA
AGAGCTAGGTGAAGCAGAATTGTTGGCAGGAGTTGCAAAATTTCCACAGCGTATCAAATGCTCTACCCTAGCTTGGAATG
CTCTCAAGGAAGCCATTAAACGAAGTGCCAATGCTCAGCACCTCACGGACCAAAATGTAAAGGAAGGGAAAAATGTCTGA

Back to Top


1323B Codon Usage

(160 codons)
fields: [triplet] [frequency: per thousand] ([number])

UUU25.0(   4)  UCU18.8(   3)  UAU0.0(   0)  UGU12.5(   2)  
UUC0.0(   0)  UCC6.2(   1)  UAC6.2(   1)  UGC6.2(   1)  
UUA6.2(   1)  UCA18.8(   3)  UAA0.0(   0)  UGA6.2(   1)  
UUG18.8(   3)  UCG6.2(   1)  UAG0.0(   0)  UGG6.2(   1)  

CUU0.0(   0)  CCU6.2(   1)  CAU31.2(   5)  CGU12.5(   2)  
CUC25.0(   4)  CCC0.0(   0)  CAC6.2(   1)  CGC0.0(   0)  
CUA25.0(   4)  CCA12.5(   2)  CAA31.2(   5)  CGA6.2(   1)  
CUG12.5(   2)  CCG6.2(   1)  CAG18.8(   3)  CGG0.0(   0)  

AUU43.8(   7)  ACU6.2(   1)  AAU43.8(   7)  AGU12.5(   2)  
AUC6.2(   1)  ACC18.8(   3)  AAC12.5(   2)  AGC6.2(   1)  
AUA0.0(   0)  ACA12.5(   2)  AAA62.5(  10)  AGA0.0(   0)  
AUG31.2(   5)  ACG6.2(   1)  AAG18.8(   3)  AGG0.0(   0)  

GUU25.0(   4)  GCU62.5(  10)  GAU37.5(   6)  GGU18.8(   3)  
GUC6.2(   1)  GCC12.5(   2)  GAC18.8(   3)  GGC18.8(   3)  
GUA25.0(   4)  GCA37.5(   6)  GAA56.2(   9)  GGA12.5(   2)  
GUG12.5(   2)  GCG12.5(   2)  GAG18.8(   3)  GGG12.5(   2)  

Back to Top


1323B Potential Cloning Problems

No UGA codons or (bad) restriction sites!

Back to Top


1323B Automatically Selected Primers

Note: These were generated using Hisao's algorithm, and do not take into account possible mispriming, self-complementarity, or requirements for mutations anywhere in the sequences. The -R1 primers are for the N-terminal end, and begin with an NdeI restriction site (CATATG). The -R2 primers are for the C-terminal end, and begin with a BamHI site (GGATCC) if the target has no other BamHI sites. If the target does have a BamHI site, the -R2 primer wil begin with a BglII site (AGATCT), unless the target has no BglII sites. If the target has both sites, the design program gives up and doesn't prepend a restriction site to the -R2 primer!

Predicted Tm was obtained using the Tm determination tool at the Virtual Genome Center.

Primer IDPredicted Tmsequence
1323B-R160.00CATATGGCACTCTCTAAACTGAACCA
1323B-R260.60GGATCCTTAGACATTTTTCCCTTCCTTTACATTT
1323B-R1063.20GGCGGTGGTGGCGGCATGGCACTCTCTAAACTGAACCATCTATAC
1323B-R1163.70GTTCTTCTCCTTTGCGCCCCTAGACATTTTTCCCTTCCTTTACATTTTG

Back to Top


1323B Translation

Note: This was generated using the standard codon usage table; UGA codons in MP/MP genes will show up as terminators ("*")

atggcactctctaaactgaaccatctatacatggctgtggtagcggaccattcgaaacgt
 M  A  L  S  K  L  N  H  L  Y  M  A  V  V  A  D  H  S  K  R 
ccacatcatcatgggcaactagatggcgtagaggctgttcaactgaataatccgacttgt
 P  H  H  H  G  Q  L  D  G  V  E  A  V  Q  L  N  N  P  T  C 
ggtgatgtgatttctttgaccgttaagtttgacgaagataaaattgaagatattgctttt
 G  D  V  I  S  L  T  V  K  F  D  E  D  K  I  E  D  I  A  F 
gcaggcaacggctgtaccatttccacagcttcatcaagcatgatgacagatgctgttatt
 A  G  N  G  C  T  I  S  T  A  S  S  S  M  M  T  D  A  V  I 
ggtaaaagtaaagaagaagcactcgcgttagctgatattttttcagagatggtacaagga
 G  K  S  K  E  E  A  L  A  L  A  D  I  F  S  E  M  V  Q  G 
caggaaaatcctgctcaaaaagagctaggtgaagcagaattgttggcaggagttgcaaaa
 Q  E  N  P  A  Q  K  E  L  G  E  A  E  L  L  A  G  V  A  K 
tttccacagcgtatcaaatgctctaccctagcttggaatgctctcaaggaagccattaaa
 F  P  Q  R  I  K  C  S  T  L  A  W  N  A  L  K  E  A  I  K 
cgaagtgccaatgctcagcacctcacggaccaaaatgtaaaggaagggaaaaatgtctga
 R  S  A  N  A  Q  H  L  T  D  Q  N  V  K  E  G  K  N  V  * 

Back to Top


1323B AA Sequence

MALSKLNHLYMAVVADHSKRPHHHGQLDGVEAVQLNNPTCGDVISLTVKFDEDKIEDIAFAGNGCTISTASSSMMTDAVI
GKSKEEALALADIFSEMVQGQENPAQKELGEAELLAGVAKFPQRIKCSTLAWNALKEAIKRSANAQHLTDQNVKEGKNV

Back to Top


1323B Protein Parameters

This information was obtained using the Protein Parameters tool on the ExPASy Molecular Biology Server.

Number of amino acids: 159

Molecular weight: 17142.4

Theoretical pI: 5.65

Amino acid composition:

Ala (A)  20	 12.6%
Arg (R)   3	  1.9%
Asn (N)   9	  5.7%
Asp (D)   9	  5.7%
Cys (C)   3	  1.9%
Gln (Q)   8	  5.0%
Glu (E)  12	  7.5%
Gly (G)  10	  6.3%
His (H)   6	  3.8%
Ile (I)   8	  5.0%
Leu (L)  14	  8.8%
Lys (K)  13	  8.2%
Met (M)   5	  3.1%
Phe (F)   4	  2.5%
Pro (P)   4	  2.5%
Ser (S)  11	  6.9%
Thr (T)   7	  4.4%
Trp (W)   1	  0.6%
Tyr (Y)   1	  0.6%
Val (V)  11	  6.9%

Asx (B)   0	  0.0%
Glx (Z)   0	  0.0%
Xaa (X)   0	  0.0%

Total number of negatively charged residues (Asp + Glu): 21
Total number of positively charged residues (Arg + Lys): 16

Atomic composition:

Carbon      C	       742
Hydrogen    H	      1201
Nitrogen    N	       211
Oxygen      O	       238
Sulfur      S	         8

Formula: C742H1201N211O238S8
Total number of atoms: 2400

Extinction coefficients:

Conditions: 6.0 M guanidium hydrochloride
            0.02 M phosphate buffer
            pH 6.5

Extinction coefficients are in units of  M-1 cm-1 .

The first table lists values computed assuming ALL Cys 
residues appear as half cystines, whereas the second table 
assumes that NONE do. 

                      276     278     279     280     282
                       nm      nm      nm      nm      nm
Ext. coefficient     6995    7127    7125    7090    6920
Abs 0.1% (=1 g/l)   0.408   0.416   0.416   0.414   0.404



                      276     278     279     280     282
                       nm      nm      nm      nm      nm
Ext. coefficient     6850    7000    7005    6970    6800
Abs 0.1% (=1 g/l)   0.400   0.408   0.409   0.407   0.397


Estimated half-life:

The N-terminal of the sequence considered is M (Met).

The estimated half-life is: 30 hours (mammalian reticulocytes, in vitro).
                            >20 hours (yeast, in vivo).
                            >10 hours (Escherichia coli, in vivo).


Instability index:

The instability index (II) is computed to be 32.61
This classifies the protein as stable.



Aliphatic index: 86.60

Grand average of hydropathicity (GRAVY): -0.271

Back to Top