|
|
This gene has the annotation "conserved hypothetical protein".
The target was selected as part of JMC's third set.
Available sections:
| Experiment | Result | User | Experiment Date |
|---|---|---|---|
| Selected | Done | jmc | 2002-11-07 |
| Cloned | Done | r_kim | 2003-08-06 |
| Expression tested | Done | r_kim | 2003-08-06 |
| Solubility tested | S | r_kim | 2003-08-06 |
| Purified | Done | r_kim | 2003-12-01 |
| Crystallized | Done | dhshin | 2003-12-02 |
| Diffraction quality crystals | Done | dhshin | 2004-01-21 |
| Native diffraction data | Done | dhshin | 2004-01-21 |
| Phasing diffraction data | Done | dhshin | 2004-01-21 |
| Traceable map | Done | dhshin | 2004-03-03 |
| Crystal structure | Done | dhshin | 2004-03-03 |
| In PDB | 1T6S | dhshin | 2004-05-07 |
| MP gene | log10(PSIBLAST E) | % identical | % coverage (of MP gene) |
|---|---|---|---|
| MP535 / MPN301 | -46.00 | 32.14 | 80.38 |
GTGCAGGAACAACGCCAACAACTTCTCCGGTCGCTTGAAGCCCTGATCTTCTCCTCGGAAGAGCCGGTCAACCTTCAGAC GCTCAGTCAGATTACCGCCCATAAGTTCACACCGAGCGAACTCCAGGAGGCGGTCGATGAACTCAACCGCGATTACGAGG CGACCGGCAGAACCTTTCGCATTCACGCCATCGCTGGCGGTTACCGTTTTCTCACCGAACCGGAATTCGCCGACCTCGTC CGCCAGCTGCTCGCGCCGGTGATCCAGCGGCGTCTTTCCCGATCCATGCTCGAAGTGCTCGCCGTGGTGGCCTGGCACCA GCCCGTCACCAAGGGCGAAATCCAGCAGATCAGGGGTGCGAGTCCCGACTACTCCATCGATCGTCTGCTTGCGCGCGGGC TCATTGAGGTGCGTGGCAGGGCCGATTCTCCCGGCAGGCCGTTGCAGTACGGTACGACAGAAGTATTTCTCGACCTGTTT CATCTGCCGAGTCTGAAAGACCTGCCCAAGTTGCGAGAAATCAAGGAGATTCTGCAGGAGCACGAGGAGCAGCAATACCT GGCTGCTGACGGCGATTTGCCGGTGGCCGCCGATGAAGATGAAAAACCACGAATGGAGAGGATTGAATGA
(210 codons) fields: [triplet] [frequency: per thousand] ([number]) UUU19.0( 4) UCU4.8( 1) UAU0.0( 0) UGU0.0( 0) UUC14.3( 3) UCC19.0( 4) UAC23.8( 5) UGC0.0( 0) UUA0.0( 0) UCA0.0( 0) UAA0.0( 0) UGA4.8( 1) UUG14.3( 3) UCG9.5( 2) UAG0.0( 0) UGG4.8( 1) CUU23.8( 5) CCU0.0( 0) CAU9.5( 2) CGU19.0( 4) CUC52.4( 11) CCC19.0( 4) CAC14.3( 3) CGC23.8( 5) CUA0.0( 0) CCA4.8( 1) CAA19.0( 4) CGA14.3( 3) CUG42.9( 9) CCG33.3( 7) CAG57.1( 12) CGG9.5( 2) AUU23.8( 5) ACU0.0( 0) AAU0.0( 0) AGU14.3( 3) AUC33.3( 7) ACC23.8( 5) AAC9.5( 2) AGC4.8( 1) AUA0.0( 0) ACA9.5( 2) AAA9.5( 2) AGA4.8( 1) AUG9.5( 2) ACG9.5( 2) AAG19.0( 4) AGG19.0( 4) GUU0.0( 0) GCU14.3( 3) GAU33.3( 7) GGU14.3( 3) GUC19.0( 4) GCC42.9( 9) GAC23.8( 5) GGC28.6( 6) GUA4.8( 1) GCA0.0( 0) GAA66.7( 14) GGA0.0( 0) GUG33.3( 7) GCG23.8( 5) GAG42.9( 9) GGG4.8( 1)
Note: These were generated using Hisao's algorithm, and do not take into account possible mispriming, self-complementarity, or requirements for mutations anywhere in the sequences. The -R1 primers are for the N-terminal end, and begin with an NdeI restriction site (CATATG). The -R2 primers are for the C-terminal end, and begin with a BamHI site (GGATCC) if the target has no other BamHI sites. If the target does have a BamHI site, the -R2 primer wil begin with a BglII site (AGATCT), unless the target has no BglII sites. If the target has both sites, the design program gives up and doesn't prepend a restriction site to the -R2 primer!
Predicted Tm was obtained using the Tm determination tool at the Virtual Genome Center.
| Primer ID | Predicted Tm | sequence |
|---|---|---|
| 1371B-R1 | 60.80 | CATATGCAGGAACAACGCCAA |
| 1371B-R2 | 62.30 | GGATCCTTATTCAATCCTCTCCATTCGTGG |
| 1371B-R10 | 64.80 | GGCGGTGGTGGCGGCATGCAGGAACAACGCCAACA |
| 1371B-R11 | 63.00 | GTTCTTCTCCTTTGCGCCCCTATTCAATCCTCTCCATTCGTGGT |
Note: This was generated using the standard codon usage table; UGA codons in MP/MP genes will show up as terminators ("*")
gtgcaggaacaacgccaacaacttctccggtcgcttgaagccctgatcttctcctcggaa V Q E Q R Q Q L L R S L E A L I F S S E gagccggtcaaccttcagacgctcagtcagattaccgcccataagttcacaccgagcgaa E P V N L Q T L S Q I T A H K F T P S E ctccaggaggcggtcgatgaactcaaccgcgattacgaggcgaccggcagaacctttcgc L Q E A V D E L N R D Y E A T G R T F R attcacgccatcgctggcggttaccgttttctcaccgaaccggaattcgccgacctcgtc I H A I A G G Y R F L T E P E F A D L V cgccagctgctcgcgccggtgatccagcggcgtctttcccgatccatgctcgaagtgctc R Q L L A P V I Q R R L S R S M L E V L gccgtggtggcctggcaccagcccgtcaccaagggcgaaatccagcagatcaggggtgcg A V V A W H Q P V T K G E I Q Q I R G A agtcccgactactccatcgatcgtctgcttgcgcgcgggctcattgaggtgcgtggcagg S P D Y S I D R L L A R G L I E V R G R gccgattctcccggcaggccgttgcagtacggtacgacagaagtatttctcgacctgttt A D S P G R P L Q Y G T T E V F L D L F catctgccgagtctgaaagacctgcccaagttgcgagaaatcaaggagattctgcaggag H L P S L K D L P K L R E I K E I L Q E cacgaggagcagcaatacctggctgctgacggcgatttgccggtggccgccgatgaagat H E E Q Q Y L A A D G D L P V A A D E D gaaaaaccacgaatggagaggattgaatga E K P R M E R I E *
MQEQRQQLLRSLEALIFSSEEPVNLQTLSQITAHKFTPSELQEAVDELNRDYEATGRTFRIHAIAGGYRFLTEPEFADLV RQLLAPVIQRRLSRSMLEVLAVVAWHQPVTKGEIQQIRGASPDYSIDRLLARGLIEVRGRADSPGRPLQYGTTEVFLDLF HLPSLKDLPKLREIKEILQEHEEQQYLAADGDLPVAADEDEKPRMERIE
This information was obtained using the Protein Parameters tool on the ExPASy Molecular Biology Server.
Number of amino acids: 209
Molecular weight: 23924.1
Theoretical pI: 5.09
Amino acid composition:
Ala (A) 17 8.1%
Arg (R) 19 9.1%
Asn (N) 2 1.0%
Asp (D) 12 5.7%
Cys (C) 0 0.0%
Gln (Q) 16 7.7%
Glu (E) 23 11.0%
Gly (G) 10 4.8%
His (H) 5 2.4%
Ile (I) 12 5.7%
Leu (L) 28 13.4%
Lys (K) 6 2.9%
Met (M) 3 1.4%
Phe (F) 7 3.3%
Pro (P) 12 5.7%
Ser (S) 11 5.3%
Thr (T) 9 4.3%
Trp (W) 1 0.5%
Tyr (Y) 5 2.4%
Val (V) 11 5.3%
Asx (B) 0 0.0%
Glx (Z) 0 0.0%
Xaa (X) 0 0.0%
Total number of negatively charged residues (Asp + Glu): 35
Total number of positively charged residues (Arg + Lys): 25
Atomic composition:
Carbon C 1060
Hydrogen H 1699
Nitrogen N 301
Oxygen O 323
Sulfur S 3
Formula: C1060H1699N301O323S3
Total number of atoms: 3386
Extinction coefficients:
Conditions: 6.0 M guanidium hydrochloride
0.02 M phosphate buffer
pH 6.5
Extinction coefficients are in units of M-1 cm-1 .
276 278 279 280 282
nm nm nm nm nm
Ext. coefficient 12650 12600 12385 12090 11600
Abs 0.1% (=1 g/l) 0.529 0.527 0.518 0.505 0.485
Estimated half-life:
The N-terminal of the sequence considered is M (Met).
The estimated half-life is: 30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Instability index:
The instability index (II) is computed to be 63.03
This classifies the protein as unstable.
Aliphatic index: 98.04
Grand average of hydropathicity (GRAVY): -0.448