Berkeley Structural Genomics Center

Target info for 1371B

This target is gi number 21646405 from Chlorobium tepidum TLS.

This gene has the annotation "conserved hypothetical protein".

The target was selected as part of JMC's third set.

Available sections:


Experimental status of 1371B

Note: Dates prior to 10/24/01 may be inaccurate, due to conversion from a record-keeping system which tracked only the last experimental date, to a new system which keeps track of all dates. The user is the person who entered the data, not the person who did the experiment. This will also change in the future.

ExperimentResultUserExperiment Date
SelectedDonejmc2002-11-07
ClonedDoner_kim2003-08-06
Expression testedDoner_kim2003-08-06
Solubility testedSr_kim2003-08-06
PurifiedDoner_kim2003-12-01
CrystallizedDonedhshin2003-12-02
Diffraction quality crystalsDonedhshin2004-01-21
Native diffraction dataDonedhshin2004-01-21
Phasing diffraction dataDonedhshin2004-01-21
Traceable mapDonedhshin2004-03-03
Crystal structureDonedhshin2004-03-03
In PDB1T6Sdhshin2004-05-07

Back to Top


Potential MP Homologues of 1371B

MP genelog10(PSIBLAST E)% identical% coverage (of MP gene)
MP535 / MPN301-46.0032.1480.38

Back to Top


1371B DNA sequence

GTGCAGGAACAACGCCAACAACTTCTCCGGTCGCTTGAAGCCCTGATCTTCTCCTCGGAAGAGCCGGTCAACCTTCAGAC
GCTCAGTCAGATTACCGCCCATAAGTTCACACCGAGCGAACTCCAGGAGGCGGTCGATGAACTCAACCGCGATTACGAGG
CGACCGGCAGAACCTTTCGCATTCACGCCATCGCTGGCGGTTACCGTTTTCTCACCGAACCGGAATTCGCCGACCTCGTC
CGCCAGCTGCTCGCGCCGGTGATCCAGCGGCGTCTTTCCCGATCCATGCTCGAAGTGCTCGCCGTGGTGGCCTGGCACCA
GCCCGTCACCAAGGGCGAAATCCAGCAGATCAGGGGTGCGAGTCCCGACTACTCCATCGATCGTCTGCTTGCGCGCGGGC
TCATTGAGGTGCGTGGCAGGGCCGATTCTCCCGGCAGGCCGTTGCAGTACGGTACGACAGAAGTATTTCTCGACCTGTTT
CATCTGCCGAGTCTGAAAGACCTGCCCAAGTTGCGAGAAATCAAGGAGATTCTGCAGGAGCACGAGGAGCAGCAATACCT
GGCTGCTGACGGCGATTTGCCGGTGGCCGCCGATGAAGATGAAAAACCACGAATGGAGAGGATTGAATGA

Back to Top


1371B Codon Usage

(210 codons)
fields: [triplet] [frequency: per thousand] ([number])

UUU19.0(   4)  UCU4.8(   1)  UAU0.0(   0)  UGU0.0(   0)  
UUC14.3(   3)  UCC19.0(   4)  UAC23.8(   5)  UGC0.0(   0)  
UUA0.0(   0)  UCA0.0(   0)  UAA0.0(   0)  UGA4.8(   1)  
UUG14.3(   3)  UCG9.5(   2)  UAG0.0(   0)  UGG4.8(   1)  

CUU23.8(   5)  CCU0.0(   0)  CAU9.5(   2)  CGU19.0(   4)  
CUC52.4(  11)  CCC19.0(   4)  CAC14.3(   3)  CGC23.8(   5)  
CUA0.0(   0)  CCA4.8(   1)  CAA19.0(   4)  CGA14.3(   3)  
CUG42.9(   9)  CCG33.3(   7)  CAG57.1(  12)  CGG9.5(   2)  

AUU23.8(   5)  ACU0.0(   0)  AAU0.0(   0)  AGU14.3(   3)  
AUC33.3(   7)  ACC23.8(   5)  AAC9.5(   2)  AGC4.8(   1)  
AUA0.0(   0)  ACA9.5(   2)  AAA9.5(   2)  AGA4.8(   1)  
AUG9.5(   2)  ACG9.5(   2)  AAG19.0(   4)  AGG19.0(   4)  

GUU0.0(   0)  GCU14.3(   3)  GAU33.3(   7)  GGU14.3(   3)  
GUC19.0(   4)  GCC42.9(   9)  GAC23.8(   5)  GGC28.6(   6)  
GUA4.8(   1)  GCA0.0(   0)  GAA66.7(  14)  GGA0.0(   0)  
GUG33.3(   7)  GCG23.8(   5)  GAG42.9(   9)  GGG4.8(   1)  

Back to Top


1371B Potential Cloning Problems

No UGA codons or (bad) restriction sites!

Back to Top


1371B Automatically Selected Primers

Note: These were generated using Hisao's algorithm, and do not take into account possible mispriming, self-complementarity, or requirements for mutations anywhere in the sequences. The -R1 primers are for the N-terminal end, and begin with an NdeI restriction site (CATATG). The -R2 primers are for the C-terminal end, and begin with a BamHI site (GGATCC) if the target has no other BamHI sites. If the target does have a BamHI site, the -R2 primer wil begin with a BglII site (AGATCT), unless the target has no BglII sites. If the target has both sites, the design program gives up and doesn't prepend a restriction site to the -R2 primer!

Predicted Tm was obtained using the Tm determination tool at the Virtual Genome Center.

Primer IDPredicted Tmsequence
1371B-R160.80CATATGCAGGAACAACGCCAA
1371B-R262.30GGATCCTTATTCAATCCTCTCCATTCGTGG
1371B-R1064.80GGCGGTGGTGGCGGCATGCAGGAACAACGCCAACA
1371B-R1163.00GTTCTTCTCCTTTGCGCCCCTATTCAATCCTCTCCATTCGTGGT

Back to Top


1371B Translation

Note: This was generated using the standard codon usage table; UGA codons in MP/MP genes will show up as terminators ("*")

gtgcaggaacaacgccaacaacttctccggtcgcttgaagccctgatcttctcctcggaa
 V  Q  E  Q  R  Q  Q  L  L  R  S  L  E  A  L  I  F  S  S  E 
gagccggtcaaccttcagacgctcagtcagattaccgcccataagttcacaccgagcgaa
 E  P  V  N  L  Q  T  L  S  Q  I  T  A  H  K  F  T  P  S  E 
ctccaggaggcggtcgatgaactcaaccgcgattacgaggcgaccggcagaacctttcgc
 L  Q  E  A  V  D  E  L  N  R  D  Y  E  A  T  G  R  T  F  R 
attcacgccatcgctggcggttaccgttttctcaccgaaccggaattcgccgacctcgtc
 I  H  A  I  A  G  G  Y  R  F  L  T  E  P  E  F  A  D  L  V 
cgccagctgctcgcgccggtgatccagcggcgtctttcccgatccatgctcgaagtgctc
 R  Q  L  L  A  P  V  I  Q  R  R  L  S  R  S  M  L  E  V  L 
gccgtggtggcctggcaccagcccgtcaccaagggcgaaatccagcagatcaggggtgcg
 A  V  V  A  W  H  Q  P  V  T  K  G  E  I  Q  Q  I  R  G  A 
agtcccgactactccatcgatcgtctgcttgcgcgcgggctcattgaggtgcgtggcagg
 S  P  D  Y  S  I  D  R  L  L  A  R  G  L  I  E  V  R  G  R 
gccgattctcccggcaggccgttgcagtacggtacgacagaagtatttctcgacctgttt
 A  D  S  P  G  R  P  L  Q  Y  G  T  T  E  V  F  L  D  L  F 
catctgccgagtctgaaagacctgcccaagttgcgagaaatcaaggagattctgcaggag
 H  L  P  S  L  K  D  L  P  K  L  R  E  I  K  E  I  L  Q  E 
cacgaggagcagcaatacctggctgctgacggcgatttgccggtggccgccgatgaagat
 H  E  E  Q  Q  Y  L  A  A  D  G  D  L  P  V  A  A  D  E  D 
gaaaaaccacgaatggagaggattgaatga
 E  K  P  R  M  E  R  I  E  * 

Back to Top


1371B AA Sequence

MQEQRQQLLRSLEALIFSSEEPVNLQTLSQITAHKFTPSELQEAVDELNRDYEATGRTFRIHAIAGGYRFLTEPEFADLV
RQLLAPVIQRRLSRSMLEVLAVVAWHQPVTKGEIQQIRGASPDYSIDRLLARGLIEVRGRADSPGRPLQYGTTEVFLDLF
HLPSLKDLPKLREIKEILQEHEEQQYLAADGDLPVAADEDEKPRMERIE

Back to Top


1371B Protein Parameters

This information was obtained using the Protein Parameters tool on the ExPASy Molecular Biology Server.

Number of amino acids: 209

Molecular weight: 23924.1

Theoretical pI: 5.09

Amino acid composition:

Ala (A)  17	  8.1%
Arg (R)  19	  9.1%
Asn (N)   2	  1.0%
Asp (D)  12	  5.7%
Cys (C)   0	  0.0%
Gln (Q)  16	  7.7%
Glu (E)  23	 11.0%
Gly (G)  10	  4.8%
His (H)   5	  2.4%
Ile (I)  12	  5.7%
Leu (L)  28	 13.4%
Lys (K)   6	  2.9%
Met (M)   3	  1.4%
Phe (F)   7	  3.3%
Pro (P)  12	  5.7%
Ser (S)  11	  5.3%
Thr (T)   9	  4.3%
Trp (W)   1	  0.5%
Tyr (Y)   5	  2.4%
Val (V)  11	  5.3%

Asx (B)   0	  0.0%
Glx (Z)   0	  0.0%
Xaa (X)   0	  0.0%

Total number of negatively charged residues (Asp + Glu): 35
Total number of positively charged residues (Arg + Lys): 25

Atomic composition:

Carbon      C	      1060
Hydrogen    H	      1699
Nitrogen    N	       301
Oxygen      O	       323
Sulfur      S	         3

Formula: C1060H1699N301O323S3
Total number of atoms: 3386

Extinction coefficients:

Conditions: 6.0 M guanidium hydrochloride
            0.02 M phosphate buffer
            pH 6.5

Extinction coefficients are in units of  M-1 cm-1 .

                      276     278     279     280     282
                       nm      nm      nm      nm      nm
Ext. coefficient    12650   12600   12385   12090   11600
Abs 0.1% (=1 g/l)   0.529   0.527   0.518   0.505   0.485


Estimated half-life:

The N-terminal of the sequence considered is M (Met).

The estimated half-life is: 30 hours (mammalian reticulocytes, in vitro).
                            >20 hours (yeast, in vivo).
                            >10 hours (Escherichia coli, in vivo).


Instability index:

The instability index (II) is computed to be 63.03
This classifies the protein as unstable.



Aliphatic index: 98.04

Grand average of hydropathicity (GRAVY): -0.448

Back to Top