Berkeley Structural Genomics Center

Target info for 1387B

This target is gi number 16129919 from Escherichia coli K12.

This gene has the annotation "orf, hypothetical protein".

The target was selected as part of pre-BSGC set.

Available sections:


Experimental status of 1387B

Note: Dates prior to 10/24/01 may be inaccurate, due to conversion from a record-keeping system which tracked only the last experimental date, to a new system which keeps track of all dates. The user is the person who entered the data, not the person who did the experiment. This will also change in the future.

ExperimentResultUserExperiment Date
SelectedDonejmc2003-09-26
ClonedDonedhshin2003-10-01
Expression testedDonedhshin2003-10-01
Solubility testedSdhshin2003-10-01
PurifiedDonedhshin2003-10-01
CrystallizedDonedhshin2003-10-01
Diffraction quality crystalsDonedhshin2003-10-01
Native diffraction dataDonedhshin2003-10-01
Phasing diffraction dataDonedhshin2003-10-01
Traceable mapDonedhshin2003-10-01
Crystal structureDonedhshin2004-01-29
In PDB1S7Ddhshin2004-01-29

Back to Top


Potential MP Homologues of 1387B

No MP homologues identified for this gene.

Back to Top


1387B DNA sequence

TTGGCGATTCGTCTTTACAAACTGGCTGTTGCTTTAGGTGTCTTTATTGTTAGCGCTCCTGCCTTTTCGCATGGTCATCA
CTCACACGGCAAACCCTTAACAGAGGTCGAACAAAAAGCTGCTAATGGTGTTTTTGATGATGCCAATGTACAAAACCGAA
CGCTCAGTGACTGGGATGGAGTCTGGCAATCCGTTTATCCTTTACTGCAAAGTGGCAAACTTGACCCCGTCTTTCAGAAG
AAAGCGGATGCAGATAAAACTAAAACATTTGCTGAAATTAAAGATTATTATCACAAAGGTTATGCAACAGATATCGAGAT
GATTGGCATTGAGGACGGCATTGTTGAATTCCATAGAAATAATGAAACAACATCGTGTAAATATGATTACGATGGATACA
AAATACTCACCTATAAATCAGGCAAGAAAGGCGTTCGTTACTTATTCGAATGTAAAGATCCTGAAAGCAAAGCCCCTAAA
TATATACAATTTAGCGATCATATAATTGCACCACGAAAATCATCTCATTTTCACATTTTTATGGGTAATGATTCACAGCA
ATCTTTATTAAATGAAATGGAAAACTGGCCAACGTATTATCCATATCAGTTGAGTAGCGAAGAAGTGGTCGAGGAAATGA
TGTCTCATTGA

Back to Top


1387B Codon Usage

(217 codons)
fields: [triplet] [frequency: per thousand] ([number])

UUU36.9(   8)  UCU13.8(   3)  UAU46.1(  10)  UGU9.2(   2)  
UUC9.2(   2)  UCC4.6(   1)  UAC18.4(   4)  UGC0.0(   0)  
UUA27.6(   6)  UCA18.4(   4)  UAA0.0(   0)  UGA4.6(   1)  
UUG9.2(   2)  UCG9.2(   2)  UAG0.0(   0)  UGG13.8(   3)  

CUU9.2(   2)  CCU18.4(   4)  CAU27.6(   6)  CGU9.2(   2)  
CUC9.2(   2)  CCC9.2(   2)  CAC18.4(   4)  CGC0.0(   0)  
CUA0.0(   0)  CCA13.8(   3)  CAA27.6(   6)  CGA9.2(   2)  
CUG9.2(   2)  CCG0.0(   0)  CAG13.8(   3)  CGG0.0(   0)  

AUU36.9(   8)  ACU4.6(   1)  AAU27.6(   6)  AGU13.8(   3)  
AUC4.6(   1)  ACC4.6(   1)  AAC9.2(   2)  AGC18.4(   4)  
AUA13.8(   3)  ACA23.0(   5)  AAA78.3(  17)  AGA4.6(   1)  
AUG23.0(   5)  ACG9.2(   2)  AAG9.2(   2)  AGG0.0(   0)  

GUU27.6(   6)  GCU27.6(   6)  GAU55.3(  12)  GGU23.0(   5)  
GUC23.0(   5)  GCC13.8(   3)  GAC13.8(   3)  GGC27.6(   6)  
GUA4.6(   1)  GCA13.8(   3)  GAA50.7(  11)  GGA9.2(   2)  
GUG4.6(   1)  GCG9.2(   2)  GAG18.4(   4)  GGG0.0(   0)  

Back to Top


1387B Potential Cloning Problems

No UGA codons or (bad) restriction sites!

Back to Top


1387B Automatically Selected Primers

Note: These were generated using Hisao's algorithm, and do not take into account possible mispriming, self-complementarity, or requirements for mutations anywhere in the sequences. The -R1 primers are for the N-terminal end, and begin with an NdeI restriction site (CATATG). The -R2 primers are for the C-terminal end, and begin with a BamHI site (GGATCC) if the target has no other BamHI sites. If the target does have a BamHI site, the -R2 primer wil begin with a BglII site (AGATCT), unless the target has no BglII sites. If the target has both sites, the design program gives up and doesn't prepend a restriction site to the -R2 primer!

Predicted Tm was obtained using the Tm determination tool at the Virtual Genome Center.

Primer IDPredicted Tmsequence
1387B-R1063.40GGCGGTGGTGGCGGCATGGCGATTCGTCTTTACAAACTG
1387B-R1164.00GTTCTTCTCCTTTGCGCCCCTAATGAGACATCATTTCCTCGACCA

Back to Top


1387B Translation

Note: This was generated using the standard codon usage table; UGA codons in MP/MP genes will show up as terminators ("*")

ttggcgattcgtctttacaaactggctgttgctttaggtgtctttattgttagcgctcct
 L  A  I  R  L  Y  K  L  A  V  A  L  G  V  F  I  V  S  A  P 
gccttttcgcatggtcatcactcacacggcaaacccttaacagaggtcgaacaaaaagct
 A  F  S  H  G  H  H  S  H  G  K  P  L  T  E  V  E  Q  K  A 
gctaatggtgtttttgatgatgccaatgtacaaaaccgaacgctcagtgactgggatgga
 A  N  G  V  F  D  D  A  N  V  Q  N  R  T  L  S  D  W  D  G 
gtctggcaatccgtttatcctttactgcaaagtggcaaacttgaccccgtctttcagaag
 V  W  Q  S  V  Y  P  L  L  Q  S  G  K  L  D  P  V  F  Q  K 
aaagcggatgcagataaaactaaaacatttgctgaaattaaagattattatcacaaaggt
 K  A  D  A  D  K  T  K  T  F  A  E  I  K  D  Y  Y  H  K  G 
tatgcaacagatatcgagatgattggcattgaggacggcattgttgaattccatagaaat
 Y  A  T  D  I  E  M  I  G  I  E  D  G  I  V  E  F  H  R  N 
aatgaaacaacatcgtgtaaatatgattacgatggatacaaaatactcacctataaatca
 N  E  T  T  S  C  K  Y  D  Y  D  G  Y  K  I  L  T  Y  K  S 
ggcaagaaaggcgttcgttacttattcgaatgtaaagatcctgaaagcaaagcccctaaa
 G  K  K  G  V  R  Y  L  F  E  C  K  D  P  E  S  K  A  P  K 
tatatacaatttagcgatcatataattgcaccacgaaaatcatctcattttcacattttt
 Y  I  Q  F  S  D  H  I  I  A  P  R  K  S  S  H  F  H  I  F 
atgggtaatgattcacagcaatctttattaaatgaaatggaaaactggccaacgtattat
 M  G  N  D  S  Q  Q  S  L  L  N  E  M  E  N  W  P  T  Y  Y 
ccatatcagttgagtagcgaagaagtggtcgaggaaatgatgtctcattga
 P  Y  Q  L  S  S  E  E  V  V  E  E  M  M  S  H  * 

Back to Top


1387B AA Sequence

MAIRLYKLAVALGVFIVSAPAFSHGHHSHGKPLTEVEQKAANGVFDDANVQNRTLSDWDGVWQSVYPLLQSGKLDPVFQK
KADADKTKTFAEIKDYYHKGYATDIEMIGIEDGIVEFHRNNETTSCKYDYDGYKILTYKSGKKGVRYLFECKDPESKAPK
YIQFSDHIIAPRKSSHFHIFMGNDSQQSLLNEMENWPTYYPYQLSSEEVVEEMMSH

Back to Top


1387B Protein Parameters

This information was obtained using the Protein Parameters tool on the ExPASy Molecular Biology Server.

Number of amino acids: 216

Molecular weight: 24761.8

Theoretical pI: 5.91

Amino acid composition:

Ala (A)  14	  6.5%
Arg (R)   5	  2.3%
Asn (N)   8	  3.7%
Asp (D)  15	  6.9%
Cys (C)   2	  0.9%
Gln (Q)   9	  4.2%
Glu (E)  15	  6.9%
Gly (G)  13	  6.0%
His (H)  10	  4.6%
Ile (I)  12	  5.6%
Leu (L)  13	  6.0%
Lys (K)  19	  8.8%
Met (M)   6	  2.8%
Phe (F)  10	  4.6%
Pro (P)   9	  4.2%
Ser (S)  17	  7.9%
Thr (T)   9	  4.2%
Trp (W)   3	  1.4%
Tyr (Y)  14	  6.5%
Val (V)  13	  6.0%

Asx (B)   0	  0.0%
Glx (Z)   0	  0.0%
Xaa (X)   0	  0.0%

Total number of negatively charged residues (Asp + Glu): 30
Total number of positively charged residues (Arg + Lys): 24

Atomic composition:

Carbon      C	      1116
Hydrogen    H	      1682
Nitrogen    N	       290
Oxygen      O	       334
Sulfur      S	         8

Formula: C1116H1682N290O334S8
Total number of atoms: 3430

Extinction coefficients:

Conditions: 6.0 M guanidium hydrochloride
            0.02 M phosphate buffer
            pH 6.5

Extinction coefficients are in units of  M-1 cm-1 .

The first table lists values computed assuming ALL Cys 
residues appear as half cystines, whereas the second table 
assumes that NONE do. 

                      276     278     279     280     282
                       nm      nm      nm      nm      nm
Ext. coefficient    36645   36527   35930   35110   33720
Abs 0.1% (=1 g/l)   1.480   1.475   1.451   1.418   1.362



                      276     278     279     280     282
                       nm      nm      nm      nm      nm
Ext. coefficient    36500   36400   35810   34990   33600
Abs 0.1% (=1 g/l)   1.474   1.470   1.446   1.413   1.357


Estimated half-life:

The N-terminal of the sequence considered is M (Met).

The estimated half-life is: 30 hours (mammalian reticulocytes, in vitro).
                            >20 hours (yeast, in vivo).
                            >10 hours (Escherichia coli, in vivo).


Instability index:

The instability index (II) is computed to be 47.83
This classifies the protein as unstable.



Aliphatic index: 69.07

Grand average of hydropathicity (GRAVY): -0.583

Back to Top