Berkeley Structural Genomics Center

Target info for 1005B

This target is gi number 1499771 from Methanococcus jannaschii.

This gene has the annotation "conserved hypothetical protein".

The target was selected as part of Igor's sets.

Available sections:


Experimental status of 1005B

Note: Dates prior to 10/24/01 may be inaccurate, due to conversion from a record-keeping system which tracked only the last experimental date, to a new system which keeps track of all dates. The user is the person who entered the data, not the person who did the experiment. This will also change in the future.

ExperimentResultUserExperiment Date
SelectedDoneshkim2001-08-24
ClonedDoneabwaight2001-08-24
Expression testedDoneabwaight2001-08-24
Solubility testedSabwaight2001-08-24
PurifiedDoner_kim2002-08-27
CrystallizedDonedhshin2002-11-21
Diffraction quality crystalsDonedhshin2002-11-21
Native diffraction dataDonedhshin2002-11-21
Phasing diffraction dataDonedhshin2002-11-22
Traceable mapDoneschen2002-12-02
Crystal structureDonedhshin2004-01-13
In PDB1S3L 1S3M 1S3Ndhshin2004-01-13
Suggested work stop995 995 995 995 5433 5433 5433 5987 5987 5987 7496 7496 7496 7981 10535 10535 10535 14409 14409 14409 14409 15312 15712 15712 15712 15712 15883 15883 15883dallen2002-12-02

Back to Top


Potential MP Homologues of 1005B

MP genelog10(PSIBLAST E)% identical% coverage (of MP gene)
MP028 / MPN126-21.0023.1798.80

Back to Top


1005B DNA sequence

ATGAAAATTGGGATAATGAGCGATACCCATGACCACTTACCCAATATTAGAAAAGCTATAGAGATTTTTAATGATGAAAA
TGTTGAGACTGTTATTCATTGTGGGGATTTTGTTAGTTTGTTTGTTATAAAAGAGTTTGAAAACTTAAACGCCAATATCA
TAGCCACTTATGGAAATAACGATGGGGAGAGATGCAAATTAAAGGAATGGTTGAAGGATATAAATGAAGAGAACATAATT
GATGATTTTATATCAGTTGAAATTGATGACCTAAAATTCTTTATAACACATGGGCATCATCAATCTGTTTTAGAGATGGC
TATTAAATCTGGTTTGTATGATGTTGTTATTTATGGACATACACATGAGAGGGTTTTTGAGGAGGTTGATGATGTTTTAG
TCATAAACCCAGGAGAATGTTGCGGTTACTTAACTGGCATTCCTACCATTGGGATATTAGACACTGAAAAGAAGGAGTAT
AGGGAGATAGTGTTAGAGTAA

Back to Top


1005B Codon Usage

(167 codons)
fields: [triplet] [frequency: per thousand] ([number])

UUU41.9(   7)  UCU12.0(   2)  UAU24.0(   4)  UGU12.0(   2)  
UUC6.0(   1)  UCC0.0(   0)  UAC6.0(   1)  UGC12.0(   2)  
UUA47.9(   8)  UCA6.0(   1)  UAA6.0(   1)  UGA0.0(   0)  
UUG18.0(   3)  UCG0.0(   0)  UAG0.0(   0)  UGG6.0(   1)  

CUU0.0(   0)  CCU6.0(   1)  CAU41.9(   7)  CGU0.0(   0)  
CUC0.0(   0)  CCC6.0(   1)  CAC6.0(   1)  CGC0.0(   0)  
CUA6.0(   1)  CCA6.0(   1)  CAA6.0(   1)  CGA0.0(   0)  
CUG0.0(   0)  CCG0.0(   0)  CAG0.0(   0)  CGG0.0(   0)  

AUU59.9(  10)  ACU24.0(   4)  AAU35.9(   6)  AGU6.0(   1)  
AUC6.0(   1)  ACC12.0(   2)  AAC29.9(   5)  AGC6.0(   1)  
AUA65.9(  11)  ACA12.0(   2)  AAA35.9(   6)  AGA12.0(   2)  
AUG18.0(   3)  ACG0.0(   0)  AAG24.0(   4)  AGG12.0(   2)  

GUU65.9(  11)  GCU12.0(   2)  GAU65.9(  11)  GGU12.0(   2)  
GUC6.0(   1)  GCC12.0(   2)  GAC18.0(   3)  GGC6.0(   1)  
GUA0.0(   0)  GCA0.0(   0)  GAA41.9(   7)  GGA18.0(   3)  
GUG6.0(   1)  GCG0.0(   0)  GAG71.9(  12)  GGG29.9(   5)  

Back to Top


1005B Potential Cloning Problems

No UGA codons or (bad) restriction sites!

Back to Top


1005B Automatically Selected Primers

Note: These were generated using Hisao's algorithm, and do not take into account possible mispriming, self-complementarity, or requirements for mutations anywhere in the sequences. The -R1 primers are for the N-terminal end, and begin with an NdeI restriction site (CATATG). The -R2 primers are for the C-terminal end, and begin with a BamHI site (GGATCC) if the target has no other BamHI sites. If the target does have a BamHI site, the -R2 primer wil begin with a BglII site (AGATCT), unless the target has no BglII sites. If the target has both sites, the design program gives up and doesn't prepend a restriction site to the -R2 primer!

Predicted Tm was obtained using the Tm determination tool at the Virtual Genome Center.

Primer IDPredicted Tmsequence
1005B-R160.00CATATGAAAATTGGGATAATGAGCG
1005B-R260.20GGATCCTTACTCTAACACTATCTCCCTATACTCCTTCT
1005B-R1065.00GGCGGTGGTGGCGGCATGAAAATTGGGATAATGAGCGATACC
1005B-R1163.00GTTCTTCTCCTTTGCGCCCCTACTCTAACACTATCTCCCTATACTCCTTCTTTTC

Back to Top


1005B Translation

Note: This was generated using the standard codon usage table; UGA codons in MP/MP genes will show up as terminators ("*")

atgaaaattgggataatgagcgatacccatgaccacttacccaatattagaaaagctata
 M  K  I  G  I  M  S  D  T  H  D  H  L  P  N  I  R  K  A  I 
gagatttttaatgatgaaaatgttgagactgttattcattgtggggattttgttagtttg
 E  I  F  N  D  E  N  V  E  T  V  I  H  C  G  D  F  V  S  L 
tttgttataaaagagtttgaaaacttaaacgccaatatcatagccacttatggaaataac
 F  V  I  K  E  F  E  N  L  N  A  N  I  I  A  T  Y  G  N  N 
gatggggagagatgcaaattaaaggaatggttgaaggatataaatgaagagaacataatt
 D  G  E  R  C  K  L  K  E  W  L  K  D  I  N  E  E  N  I  I 
gatgattttatatcagttgaaattgatgacctaaaattctttataacacatgggcatcat
 D  D  F  I  S  V  E  I  D  D  L  K  F  F  I  T  H  G  H  H 
caatctgttttagagatggctattaaatctggtttgtatgatgttgttatttatggacat
 Q  S  V  L  E  M  A  I  K  S  G  L  Y  D  V  V  I  Y  G  H 
acacatgagagggtttttgaggaggttgatgatgttttagtcataaacccaggagaatgt
 T  H  E  R  V  F  E  E  V  D  D  V  L  V  I  N  P  G  E  C 
tgcggttacttaactggcattcctaccattgggatattagacactgaaaagaaggagtat
 C  G  Y  L  T  G  I  P  T  I  G  I  L  D  T  E  K  K  E  Y 
agggagatagtgttagagtaa
 R  E  I  V  L  E  * 

Back to Top


1005B AA Sequence

MKIGIMSDTHDHLPNIRKAIEIFNDENVETVIHCGDFVSLFVIKEFENLNANIIATYGNNDGERCKLKEWLKDINEENII
DDFISVEIDDLKFFITHGHHQSVLEMAIKSGLYDVVIYGHTHERVFEEVDDVLVINPGECCGYLTGIPTIGILDTEKKEY
REIVLE

Back to Top


1005B Protein Parameters

This information was obtained using the Protein Parameters tool on the ExPASy Molecular Biology Server.

Number of amino acids: 166

Molecular weight: 19038.5

Theoretical pI: 4.61

Amino acid composition:

Ala (A)   4	  2.4%
Arg (R)   4	  2.4%
Asn (N)  11	  6.6%
Asp (D)  14	  8.4%
Cys (C)   4	  2.4%
Gln (Q)   1	  0.6%
Glu (E)  19	 11.4%
Gly (G)  11	  6.6%
His (H)   8	  4.8%
Ile (I)  22	 13.3%
Leu (L)  12	  7.2%
Lys (K)  10	  6.0%
Met (M)   3	  1.8%
Phe (F)   8	  4.8%
Pro (P)   3	  1.8%
Ser (S)   5	  3.0%
Thr (T)   8	  4.8%
Trp (W)   1	  0.6%
Tyr (Y)   5	  3.0%
Val (V)  13	  7.8%

Asx (B)   0	  0.0%
Glx (Z)   0	  0.0%
Xaa (X)   0	  0.0%

Total number of negatively charged residues (Asp + Glu): 33
Total number of positively charged residues (Arg + Lys): 14

Atomic composition:

Carbon      C	       852
Hydrogen    H	      1323
Nitrogen    N	       217
Oxygen      O	       263
Sulfur      S	         7

Formula: C852H1323N217O263S7
Total number of atoms: 2662

Extinction coefficients:

Conditions: 6.0 M guanidium hydrochloride
            0.02 M phosphate buffer
            pH 6.5

Extinction coefficients are in units of  M-1 cm-1 .

The first table lists values computed assuming ALL Cys 
residues appear as half cystines, whereas the second table 
assumes that NONE do. 

                      276     278     279     280     282
                       nm      nm      nm      nm      nm
Ext. coefficient    12940   12854   12625   12330   11840
Abs 0.1% (=1 g/l)   0.680   0.675   0.663   0.648   0.622



                      276     278     279     280     282
                       nm      nm      nm      nm      nm
Ext. coefficient    12650   12600   12385   12090   11600
Abs 0.1% (=1 g/l)   0.664   0.662   0.651   0.635   0.609


Estimated half-life:

The N-terminal of the sequence considered is M (Met).

The estimated half-life is: 30 hours (mammalian reticulocytes, in vitro).
                            >20 hours (yeast, in vivo).
                            >10 hours (Escherichia coli, in vivo).


Instability index:

The instability index (II) is computed to be 26.95
This classifies the protein as stable.



Aliphatic index: 105.00

Grand average of hydropathicity (GRAVY): -0.131

Back to Top