|
|
This gene has the annotation "conserved hypothetical protein".
The target was selected as part of Igor's sets.
Available sections:
| Experiment | Result | User | Experiment Date |
|---|---|---|---|
| Selected | Done | shkim | 2001-08-24 |
| Cloned | Done | abwaight | 2001-08-24 |
| Expression tested | Done | abwaight | 2001-08-24 |
| Solubility tested | S | abwaight | 2001-08-24 |
| Purified | Done | r_kim | 2002-08-27 |
| Crystallized | Done | dhshin | 2002-11-21 |
| Diffraction quality crystals | Done | dhshin | 2002-11-21 |
| Native diffraction data | Done | dhshin | 2002-11-21 |
| Phasing diffraction data | Done | dhshin | 2002-11-22 |
| Traceable map | Done | schen | 2002-12-02 |
| Crystal structure | Done | dhshin | 2004-01-13 |
| In PDB | 1S3L 1S3M 1S3N | dhshin | 2004-01-13 |
| Suggested work stop | 995 995 995 995 5433 5433 5433 5987 5987 5987 7496 7496 7496 7981 10535 10535 10535 14409 14409 14409 14409 15312 15712 15712 15712 15712 15883 15883 15883 | dallen | 2002-12-02 |
| MP gene | log10(PSIBLAST E) | % identical | % coverage (of MP gene) |
|---|---|---|---|
| MP028 / MPN126 | -21.00 | 23.17 | 98.80 |
ATGAAAATTGGGATAATGAGCGATACCCATGACCACTTACCCAATATTAGAAAAGCTATAGAGATTTTTAATGATGAAAA TGTTGAGACTGTTATTCATTGTGGGGATTTTGTTAGTTTGTTTGTTATAAAAGAGTTTGAAAACTTAAACGCCAATATCA TAGCCACTTATGGAAATAACGATGGGGAGAGATGCAAATTAAAGGAATGGTTGAAGGATATAAATGAAGAGAACATAATT GATGATTTTATATCAGTTGAAATTGATGACCTAAAATTCTTTATAACACATGGGCATCATCAATCTGTTTTAGAGATGGC TATTAAATCTGGTTTGTATGATGTTGTTATTTATGGACATACACATGAGAGGGTTTTTGAGGAGGTTGATGATGTTTTAG TCATAAACCCAGGAGAATGTTGCGGTTACTTAACTGGCATTCCTACCATTGGGATATTAGACACTGAAAAGAAGGAGTAT AGGGAGATAGTGTTAGAGTAA
(167 codons) fields: [triplet] [frequency: per thousand] ([number]) UUU41.9( 7) UCU12.0( 2) UAU24.0( 4) UGU12.0( 2) UUC6.0( 1) UCC0.0( 0) UAC6.0( 1) UGC12.0( 2) UUA47.9( 8) UCA6.0( 1) UAA6.0( 1) UGA0.0( 0) UUG18.0( 3) UCG0.0( 0) UAG0.0( 0) UGG6.0( 1) CUU0.0( 0) CCU6.0( 1) CAU41.9( 7) CGU0.0( 0) CUC0.0( 0) CCC6.0( 1) CAC6.0( 1) CGC0.0( 0) CUA6.0( 1) CCA6.0( 1) CAA6.0( 1) CGA0.0( 0) CUG0.0( 0) CCG0.0( 0) CAG0.0( 0) CGG0.0( 0) AUU59.9( 10) ACU24.0( 4) AAU35.9( 6) AGU6.0( 1) AUC6.0( 1) ACC12.0( 2) AAC29.9( 5) AGC6.0( 1) AUA65.9( 11) ACA12.0( 2) AAA35.9( 6) AGA12.0( 2) AUG18.0( 3) ACG0.0( 0) AAG24.0( 4) AGG12.0( 2) GUU65.9( 11) GCU12.0( 2) GAU65.9( 11) GGU12.0( 2) GUC6.0( 1) GCC12.0( 2) GAC18.0( 3) GGC6.0( 1) GUA0.0( 0) GCA0.0( 0) GAA41.9( 7) GGA18.0( 3) GUG6.0( 1) GCG0.0( 0) GAG71.9( 12) GGG29.9( 5)
Note: These were generated using Hisao's algorithm, and do not take into account possible mispriming, self-complementarity, or requirements for mutations anywhere in the sequences. The -R1 primers are for the N-terminal end, and begin with an NdeI restriction site (CATATG). The -R2 primers are for the C-terminal end, and begin with a BamHI site (GGATCC) if the target has no other BamHI sites. If the target does have a BamHI site, the -R2 primer wil begin with a BglII site (AGATCT), unless the target has no BglII sites. If the target has both sites, the design program gives up and doesn't prepend a restriction site to the -R2 primer!
Predicted Tm was obtained using the Tm determination tool at the Virtual Genome Center.
| Primer ID | Predicted Tm | sequence |
|---|---|---|
| 1005B-R1 | 60.00 | CATATGAAAATTGGGATAATGAGCG |
| 1005B-R2 | 60.20 | GGATCCTTACTCTAACACTATCTCCCTATACTCCTTCT |
| 1005B-R10 | 65.00 | GGCGGTGGTGGCGGCATGAAAATTGGGATAATGAGCGATACC |
| 1005B-R11 | 63.00 | GTTCTTCTCCTTTGCGCCCCTACTCTAACACTATCTCCCTATACTCCTTCTTTTC |
Note: This was generated using the standard codon usage table; UGA codons in MP/MP genes will show up as terminators ("*")
atgaaaattgggataatgagcgatacccatgaccacttacccaatattagaaaagctata M K I G I M S D T H D H L P N I R K A I gagatttttaatgatgaaaatgttgagactgttattcattgtggggattttgttagtttg E I F N D E N V E T V I H C G D F V S L tttgttataaaagagtttgaaaacttaaacgccaatatcatagccacttatggaaataac F V I K E F E N L N A N I I A T Y G N N gatggggagagatgcaaattaaaggaatggttgaaggatataaatgaagagaacataatt D G E R C K L K E W L K D I N E E N I I gatgattttatatcagttgaaattgatgacctaaaattctttataacacatgggcatcat D D F I S V E I D D L K F F I T H G H H caatctgttttagagatggctattaaatctggtttgtatgatgttgttatttatggacat Q S V L E M A I K S G L Y D V V I Y G H acacatgagagggtttttgaggaggttgatgatgttttagtcataaacccaggagaatgt T H E R V F E E V D D V L V I N P G E C tgcggttacttaactggcattcctaccattgggatattagacactgaaaagaaggagtat C G Y L T G I P T I G I L D T E K K E Y agggagatagtgttagagtaa R E I V L E *
MKIGIMSDTHDHLPNIRKAIEIFNDENVETVIHCGDFVSLFVIKEFENLNANIIATYGNNDGERCKLKEWLKDINEENII DDFISVEIDDLKFFITHGHHQSVLEMAIKSGLYDVVIYGHTHERVFEEVDDVLVINPGECCGYLTGIPTIGILDTEKKEY REIVLE
This information was obtained using the Protein Parameters tool on the ExPASy Molecular Biology Server.
Number of amino acids: 166
Molecular weight: 19038.5
Theoretical pI: 4.61
Amino acid composition:
Ala (A) 4 2.4%
Arg (R) 4 2.4%
Asn (N) 11 6.6%
Asp (D) 14 8.4%
Cys (C) 4 2.4%
Gln (Q) 1 0.6%
Glu (E) 19 11.4%
Gly (G) 11 6.6%
His (H) 8 4.8%
Ile (I) 22 13.3%
Leu (L) 12 7.2%
Lys (K) 10 6.0%
Met (M) 3 1.8%
Phe (F) 8 4.8%
Pro (P) 3 1.8%
Ser (S) 5 3.0%
Thr (T) 8 4.8%
Trp (W) 1 0.6%
Tyr (Y) 5 3.0%
Val (V) 13 7.8%
Asx (B) 0 0.0%
Glx (Z) 0 0.0%
Xaa (X) 0 0.0%
Total number of negatively charged residues (Asp + Glu): 33
Total number of positively charged residues (Arg + Lys): 14
Atomic composition:
Carbon C 852
Hydrogen H 1323
Nitrogen N 217
Oxygen O 263
Sulfur S 7
Formula: C852H1323N217O263S7
Total number of atoms: 2662
Extinction coefficients:
Conditions: 6.0 M guanidium hydrochloride
0.02 M phosphate buffer
pH 6.5
Extinction coefficients are in units of M-1 cm-1 .
The first table lists values computed assuming ALL Cys
residues appear as half cystines, whereas the second table
assumes that NONE do.
276 278 279 280 282
nm nm nm nm nm
Ext. coefficient 12940 12854 12625 12330 11840
Abs 0.1% (=1 g/l) 0.680 0.675 0.663 0.648 0.622
276 278 279 280 282
nm nm nm nm nm
Ext. coefficient 12650 12600 12385 12090 11600
Abs 0.1% (=1 g/l) 0.664 0.662 0.651 0.635 0.609
Estimated half-life:
The N-terminal of the sequence considered is M (Met).
The estimated half-life is: 30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Instability index:
The instability index (II) is computed to be 26.95
This classifies the protein as stable.
Aliphatic index: 105.00
Grand average of hydropathicity (GRAVY): -0.131