|
|
This gene has the annotation "lipoprotein, putative".
The target was selected as part of First domain set.
Available sections:
| Experiment | Result | User | Experiment Date |
|---|---|---|---|
| Selected | Done | jmc | 2004-03-22 |
| Cloned | Done | cshong | 2004-08-06 |
| Expression tested | Done | cshong | 2004-08-06 |
| Solubility tested | S | hayokota | 2004-08-24 |
| Work stopped | uncertainty in predicting domain boundaries | jmc | 2005-02-25 |
| MP gene | log10(PSIBLAST E) | % identical | % coverage (of MP gene) |
|---|---|---|---|
| MP002 / MPN152 | -30.70 | 62.64 | 100.00 |
| MP007 / MPN147 | -29.15 | 57.14 | 100.00 |
| MP336 / MPN506 | -30.70 | 51.19 | 92.31 |
| MP430 / MPN408 | -31.30 | 50.00 | 98.90 |
| MP472 / MPN364 | -30.30 | 53.85 | 100.00 |
| MP547 / MPN288 | -31.40 | 57.14 | 100.00 |
| MP551 / MPN284 | -33.70 | 59.34 | 100.00 |
| MP553 / MPN282 | -28.52 | 55.56 | 98.90 |
| MP631 / MPN200 | -28.70 | 52.75 | 100.00 |
| MP632 / MPN199 | -18.70 | 34.44 | 98.90 |
TTAATTAATATTCTTGAACAAGCAAAACAAAAAAACACTGCACAAGGAAGTGAATCAACCACTAACAAGATAATAGGTTA TACCACCACTGCAAATGTTAATGTTGATAATCAAAACATCTTTTCTGTTAGCAAACTTAACAACGAACAGTTTCAAAGAA AAATCATTGTTAATGCCACTGAAGAAACACTTGATCAATCCCAAACCTTACAGAGCAATGAATCAATTGTTTTACCAATG CCTGGTAAATACAAATCAACTGATAAAAATAAA
(91 codons) fields: [triplet] [frequency: per thousand] ([number]) UUU22.0( 2) UCU11.0( 1) UAU11.0( 1) UGU0.0( 0) UUC0.0( 0) UCC11.0( 1) UAC11.0( 1) UGC0.0( 0) UUA33.0( 3) UCA33.0( 3) UAA0.0( 0) UGA0.0( 0) UUG0.0( 0) UCG0.0( 0) UAG0.0( 0) UGG0.0( 0) CUU33.0( 3) CCU11.0( 1) CAU0.0( 0) CGU0.0( 0) CUC0.0( 0) CCC0.0( 0) CAC0.0( 0) CGC0.0( 0) CUA0.0( 0) CCA11.0( 1) CAA76.9( 7) CGA0.0( 0) CUG0.0( 0) CCG0.0( 0) CAG22.0( 2) CGG0.0( 0) AUU44.0( 4) ACU54.9( 5) AAU76.9( 7) AGU11.0( 1) AUC22.0( 2) ACC44.0( 4) AAC54.9( 5) AGC22.0( 2) AUA22.0( 2) ACA11.0( 1) AAA87.9( 8) AGA11.0( 1) AUG11.0( 1) ACG0.0( 0) AAG11.0( 1) AGG0.0( 0) GUU54.9( 5) GCU0.0( 0) GAU33.0( 3) GGU22.0( 2) GUC0.0( 0) GCC11.0( 1) GAC0.0( 0) GGC0.0( 0) GUA0.0( 0) GCA33.0( 3) GAA65.9( 6) GGA11.0( 1) GUG0.0( 0) GCG0.0( 0) GAG0.0( 0) GGG0.0( 0)
Details (problem DNA region is in upper case, with the key on the line below):
Key:
ttaattaatattcttgaacaagcaaaacaaaaaaacactgcacaaggaagtgaatcaacc
actaacaagataataggttataccaccactgcaaatgttaatgttgataatcaaaacatc
ttttctgttagcaaacttaacaacgaacagtttcaaagaaaaatcattgttaatgccact
gaagaaacactTGATCAatcccaaaccttacagagcaatgaatcaattgttttaccaatg
3
cctggtaaatacaaatcaactgataaaaataaa
Note: These were generated using Hisao's algorithm, and do not take into account possible mispriming, self-complementarity, or requirements for mutations anywhere in the sequences. The -R1 primers are for the N-terminal end, and begin with an NdeI restriction site (CATATG). The -R2 primers are for the C-terminal end, and begin with a BamHI site (GGATCC) if the target has no other BamHI sites. If the target does have a BamHI site, the -R2 primer wil begin with a BglII site (AGATCT), unless the target has no BglII sites. If the target has both sites, the design program gives up and doesn't prepend a restriction site to the -R2 primer!
Predicted Tm was obtained using the Tm determination tool at the Virtual Genome Center.
| Primer ID | Predicted Tm | sequence |
|---|---|---|
| 1617T-R10 | 63.10 | GGCGGTGGTGGCGGCATGTTAATTAATATTCTTGAACAAGCAAAACAAAAA |
| 1617T-R11 | 64.80 | GTTCTTCTCCTTTGCGCCCCTATTTATTTTTATCAGTTGATTTGTATTTACCAGGC |
Note: This was generated using the standard codon usage table; UGA codons in MP/MP genes will show up as terminators ("*")
ttaattaatattcttgaacaagcaaaacaaaaaaacactgcacaaggaagtgaatcaacc L I N I L E Q A K Q K N T A Q G S E S T actaacaagataataggttataccaccactgcaaatgttaatgttgataatcaaaacatc T N K I I G Y T T T A N V N V D N Q N I ttttctgttagcaaacttaacaacgaacagtttcaaagaaaaatcattgttaatgccact F S V S K L N N E Q F Q R K I I V N A T gaagaaacacttgatcaatcccaaaccttacagagcaatgaatcaattgttttaccaatg E E T L D Q S Q T L Q S N E S I V L P M cctggtaaatacaaatcaactgataaaaataaa P G K Y K S T D K N K
LINILEQAKQKNTAQGSESTTNKIIGYTTTANVNVDNQNIFSVSKLNNEQFQRKIIVNATEETLDQSQTLQSNESIVLPM PGKYKSTDKNK
This information was obtained using the Protein Parameters tool on the ExPASy Molecular Biology Server.
Number of amino acids: 91
Molecular weight: 10159.3
Theoretical pI: 8.19
Amino acid composition:
Ala (A) 4 4.4%
Arg (R) 1 1.1%
Asn (N) 12 13.2%
Asp (D) 3 3.3%
Cys (C) 0 0.0%
Gln (Q) 9 9.9%
Glu (E) 6 6.6%
Gly (G) 3 3.3%
His (H) 0 0.0%
Ile (I) 8 8.8%
Leu (L) 6 6.6%
Lys (K) 9 9.9%
Met (M) 1 1.1%
Phe (F) 2 2.2%
Pro (P) 2 2.2%
Ser (S) 8 8.8%
Thr (T) 10 11.0%
Trp (W) 0 0.0%
Tyr (Y) 2 2.2%
Val (V) 5 5.5%
Asx (B) 0 0.0%
Glx (Z) 0 0.0%
Xaa (X) 0 0.0%
Total number of negatively charged residues (Asp + Glu): 9
Total number of positively charged residues (Arg + Lys): 10
Atomic composition:
Carbon C 437
Hydrogen H 720
Nitrogen N 124
Oxygen O 151
Sulfur S 1
Formula: C437H720N124O151S1
Total number of atoms: 1433
Extinction coefficients:
Conditions: 6.0 M guanidium hydrochloride
0.02 M phosphate buffer
pH 6.5
Extinction coefficients are in units of M-1 cm-1 .
276 278 279 280 282
nm nm nm nm nm
Ext. coefficient 2900 2800 2690 2560 2400
Abs 0.1% (=1 g/l) 0.285 0.276 0.265 0.252 0.236
Estimated half-life:
The N-terminal of the sequence considered is L (Leu).
The estimated half-life is: 5.5 hours (mammalian reticulocytes, in vitro).
3 min (yeast, in vivo).
2 min (Escherichia coli, in vivo).
Instability index:
The instability index (II) is computed to be 52.93
This classifies the protein as unstable.
Aliphatic index: 80.33
Grand average of hydropathicity (GRAVY): -0.775