Berkeley Structural Genomics Center

Target info for 1660T

This target is
Warning: mysql_fetch_object(): supplied argument is not a valid MySQL result resource in /home/httpd/strgen/r050111/status/common_db.php on line 537
MP000, gi number 13507885 from Mycoplasma pneumoniae.

This gene has the annotation "conserved hypothetical protein".

The target was selected as part of First domain set.

Available sections:


Experimental status of 1660T

Note: Dates prior to 10/24/01 may be inaccurate, due to conversion from a record-keeping system which tracked only the last experimental date, to a new system which keeps track of all dates. The user is the person who entered the data, not the person who did the experiment. This will also change in the future.

ExperimentResultUserExperiment Date
SelectedDonejmc2004-03-22
ClonedDonecshong2004-06-15
Expression testedDonecshong2004-06-15
Work stoppeduncertainty in predicting domain boundariesjmc2005-02-25

Back to Top


Potential MP Homologues of 1660T

MP genelog10(PSIBLAST E)% identical% coverage (of MP gene)
MP002 / MPN152-36.3067.07100.00
MP008 / MPN146-35.40100.00100.00
MP057 / MPN097-36.5273.17100.00
MP336 / MPN506-37.0069.51100.00
MP430 / MPN408-32.2242.68100.00
MP473 / MPN363-35.5270.73100.00
MP547 / MPN288-36.2267.07100.00
MP551 / MPN284-35.3067.07100.00
MP554 / MPN281-36.7069.51100.00
MP631 / MPN200-35.2263.41100.00
MP632 / MPN199-29.1050.00100.00

Back to Top


1660T DNA sequence

ATGTTGGCTAGTTGTGGTGCTAAAGGGCGTTTTGACCAGGTTGATGATGGCAAAATTAAGCTAGCTTCTTCACTTACCGG
TAAGCGCGATGTGATACTGCAAGAAGTGCTCAACAAATATAACAGTCGCAAAGCCAAGGACGATTATCCGATTGAAATAA
CCAAAATAGCCGGTAGCTATGATGGTGGTCGATCTGATCTGCAAACGCGGTTGAGTGTCAAGGATAAAACAACCTTTTAC
AACATG

Back to Top


1660T Codon Usage

(82 codons)
fields: [triplet] [frequency: per thousand] ([number])

UUU24.4(   2)  UCU24.4(   2)  UAU36.6(   3)  UGU12.2(   1)  
UUC0.0(   0)  UCC0.0(   0)  UAC12.2(   1)  UGC0.0(   0)  
UUA0.0(   0)  UCA12.2(   1)  UAA0.0(   0)  UGA0.0(   0)  
UUG24.4(   2)  UCG0.0(   0)  UAG0.0(   0)  UGG0.0(   0)  

CUU12.2(   1)  CCU0.0(   0)  CAU0.0(   0)  CGU12.2(   1)  
CUC12.2(   1)  CCC0.0(   0)  CAC0.0(   0)  CGC24.4(   2)  
CUA12.2(   1)  CCA0.0(   0)  CAA24.4(   2)  CGA12.2(   1)  
CUG24.4(   2)  CCG12.2(   1)  CAG12.2(   1)  CGG12.2(   1)  

AUU24.4(   2)  ACU0.0(   0)  AAU0.0(   0)  AGU36.6(   3)  
AUC0.0(   0)  ACC36.6(   3)  AAC36.6(   3)  AGC12.2(   1)  
AUA36.6(   3)  ACA12.2(   1)  AAA73.2(   6)  AGA0.0(   0)  
AUG24.4(   2)  ACG12.2(   1)  AAG48.8(   4)  AGG0.0(   0)  

GUU12.2(   1)  GCU36.6(   3)  GAU85.4(   7)  GGU61.0(   5)  
GUC12.2(   1)  GCC24.4(   2)  GAC24.4(   2)  GGC12.2(   1)  
GUA0.0(   0)  GCA0.0(   0)  GAA24.4(   2)  GGA0.0(   0)  
GUG24.4(   2)  GCG0.0(   0)  GAG0.0(   0)  GGG12.2(   1)  

Back to Top


1660T Potential Cloning Problems

No UGA codons or (bad) restriction sites!

Back to Top


1660T Automatically Selected Primers

Note: These were generated using Hisao's algorithm, and do not take into account possible mispriming, self-complementarity, or requirements for mutations anywhere in the sequences. The -R1 primers are for the N-terminal end, and begin with an NdeI restriction site (CATATG). The -R2 primers are for the C-terminal end, and begin with a BamHI site (GGATCC) if the target has no other BamHI sites. If the target does have a BamHI site, the -R2 primer wil begin with a BglII site (AGATCT), unless the target has no BglII sites. If the target has both sites, the design program gives up and doesn't prepend a restriction site to the -R2 primer!

Predicted Tm was obtained using the Tm determination tool at the Virtual Genome Center.

Primer IDPredicted Tmsequence
1660T-R1065.50GGCGGTGGTGGCGGCATGATGTTGGCTAGTTGTGGTGCTAAAGG
1660T-R1163.40GTTCTTCTCCTTTGCGCCCCTACATGTTGTAAAAGGTTGTTTTATCCTTGA

Back to Top


1660T Translation

Note: This was generated using the standard codon usage table; UGA codons in MP/MP genes will show up as terminators ("*")

atgttggctagttgtggtgctaaagggcgttttgaccaggttgatgatggcaaaattaag
 M  L  A  S  C  G  A  K  G  R  F  D  Q  V  D  D  G  K  I  K 
ctagcttcttcacttaccggtaagcgcgatgtgatactgcaagaagtgctcaacaaatat
 L  A  S  S  L  T  G  K  R  D  V  I  L  Q  E  V  L  N  K  Y 
aacagtcgcaaagccaaggacgattatccgattgaaataaccaaaatagccggtagctat
 N  S  R  K  A  K  D  D  Y  P  I  E  I  T  K  I  A  G  S  Y 
gatggtggtcgatctgatctgcaaacgcggttgagtgtcaaggataaaacaaccttttac
 D  G  G  R  S  D  L  Q  T  R  L  S  V  K  D  K  T  T  F  Y 
aacatg
 N  M 

Back to Top


1660T AA Sequence

MLASCGAKGRFDQVDDGKIKLASSLTGKRDVILQEVLNKYNSRKAKDDYPIEITKIAGSYDGGRSDLQTRLSVKDKTTFY
NM

Back to Top


1660T Protein Parameters

This information was obtained using the Protein Parameters tool on the ExPASy Molecular Biology Server.

Number of amino acids: 82

Molecular weight: 9135.4

Theoretical pI: 9.30

Amino acid composition:

Ala (A)   5	  6.1%
Arg (R)   5	  6.1%
Asn (N)   3	  3.7%
Asp (D)   9	 11.0%
Cys (C)   1	  1.2%
Gln (Q)   3	  3.7%
Glu (E)   2	  2.4%
Gly (G)   7	  8.5%
His (H)   0	  0.0%
Ile (I)   5	  6.1%
Leu (L)   7	  8.5%
Lys (K)  10	 12.2%
Met (M)   2	  2.4%
Phe (F)   2	  2.4%
Pro (P)   1	  1.2%
Ser (S)   7	  8.5%
Thr (T)   5	  6.1%
Trp (W)   0	  0.0%
Tyr (Y)   4	  4.9%
Val (V)   4	  4.9%

Asx (B)   0	  0.0%
Glx (Z)   0	  0.0%
Xaa (X)   0	  0.0%

Total number of negatively charged residues (Asp + Glu): 11
Total number of positively charged residues (Arg + Lys): 15

Atomic composition:

Carbon      C	       397
Hydrogen    H	       651
Nitrogen    N	       113
Oxygen      O	       127
Sulfur      S	         3

Formula: C397H651N113O127S3
Total number of atoms: 1291

Extinction coefficients:

Conditions: 6.0 M guanidium hydrochloride
            0.02 M phosphate buffer
            pH 6.5

Extinction coefficients are in units of  M-1 cm-1 .

The first table lists values computed assuming ALL Cys 
residues appear as half cystines, whereas the second table 
assumes that NONE do. 

                      276     278     279     280     282
                       nm      nm      nm      nm      nm
Ext. coefficient     5800    5600    5380    5120    4800
Abs 0.1% (=1 g/l)   0.635   0.613   0.589   0.560   0.525



                      276     278     279     280     282
                       nm      nm      nm      nm      nm
Ext. coefficient     5800    5600    5380    5120    4800
Abs 0.1% (=1 g/l)   0.635   0.613   0.589   0.560   0.525


Estimated half-life:

The N-terminal of the sequence considered is M (Met).

The estimated half-life is: 30 hours (mammalian reticulocytes, in vitro).
                            >20 hours (yeast, in vivo).
                            >10 hours (Escherichia coli, in vivo).


Instability index:

The instability index (II) is computed to be 50.55
This classifies the protein as unstable.



Aliphatic index: 77.32

Grand average of hydropathicity (GRAVY): -0.645

Back to Top