|
|
This gene has the annotation "conserved hypothetical protein".
The target was selected as part of First domain set.
Available sections:
| Experiment | Result | User | Experiment Date |
|---|---|---|---|
| Selected | Done | jmc | 2004-03-22 |
| Cloned | Done | cshong | 2004-06-15 |
| Expression tested | Done | cshong | 2004-06-15 |
| Solubility tested | S | jgpelton | 2004-10-14 |
| Purified | Done | jgpelton | 2004-10-14 |
| NMR characterization | Done | jgpelton | 2004-10-14 |
| Work stopped | uncertainty in predicting domain boundaries | jmc | 2005-02-25 |
| MP gene | log10(PSIBLAST E) | % identical | % coverage (of MP gene) |
|---|---|---|---|
| MP002 / MPN152 | -30.10 | 52.44 | 100.00 |
| MP007 / MPN147 | -25.00 | 46.34 | 100.00 |
| MP057 / MPN097 | -27.22 | 50.00 | 100.00 |
| MP336 / MPN506 | -29.05 | 56.10 | 100.00 |
| MP430 / MPN408 | -26.00 | 45.12 | 100.00 |
| MP472 / MPN364 | -27.40 | 52.44 | 100.00 |
| MP547 / MPN288 | -29.00 | 56.10 | 100.00 |
| MP551 / MPN284 | -28.00 | 52.44 | 100.00 |
| MP554 / MPN281 | -28.70 | 51.85 | 98.78 |
| MP631 / MPN200 | -27.40 | 52.44 | 100.00 |
| MP632 / MPN199 | -28.00 | 100.00 | 100.00 |
TTAAACGATTTTGCAGTACGGGTAGCAAAGTCGTTTAGCAAGGTTTCTGAAGAGAAGAAAAGTGGTAGTGACATCCAGGG TGTTTTTGGCATTGGTAGTTTAGAAAATGCGCTTTACACTGCATCATTTGCAGCCGGTGGTGGCGACTATAACAACTTCT TGTTTAACATTAAAAAAGGTCGCGCTGATTTTAGTAACTTCTTTAACCACAATTCAAAAACTTTCCAAAGTCTAAGAGAT ATTTTC
(82 codons) fields: [triplet] [frequency: per thousand] ([number]) UUU85.4( 7) UCU12.2( 1) UAU12.2( 1) UGU0.0( 0) UUC48.8( 4) UCC0.0( 0) UAC12.2( 1) UGC0.0( 0) UUA24.4( 2) UCA24.4( 2) UAA0.0( 0) UGA0.0( 0) UUG12.2( 1) UCG12.2( 1) UAG0.0( 0) UGG0.0( 0) CUU12.2( 1) CCU0.0( 0) CAU0.0( 0) CGU0.0( 0) CUC0.0( 0) CCC0.0( 0) CAC12.2( 1) CGC12.2( 1) CUA12.2( 1) CCA0.0( 0) CAA12.2( 1) CGA0.0( 0) CUG0.0( 0) CCG0.0( 0) CAG12.2( 1) CGG12.2( 1) AUU36.6( 3) ACU24.4( 2) AAU24.4( 2) AGU61.0( 5) AUC12.2( 1) ACC0.0( 0) AAC73.2( 6) AGC12.2( 1) AUA0.0( 0) ACA0.0( 0) AAA48.8( 4) AGA12.2( 1) AUG0.0( 0) ACG0.0( 0) AAG36.6( 3) AGG0.0( 0) GUU24.4( 2) GCU12.2( 1) GAU36.6( 3) GGU73.2( 6) GUC0.0( 0) GCC12.2( 1) GAC24.4( 2) GGC24.4( 2) GUA24.4( 2) GCA48.8( 4) GAA24.4( 2) GGA0.0( 0) GUG0.0( 0) GCG12.2( 1) GAG12.2( 1) GGG0.0( 0)
Note: These were generated using Hisao's algorithm, and do not take into account possible mispriming, self-complementarity, or requirements for mutations anywhere in the sequences. The -R1 primers are for the N-terminal end, and begin with an NdeI restriction site (CATATG). The -R2 primers are for the C-terminal end, and begin with a BamHI site (GGATCC) if the target has no other BamHI sites. If the target does have a BamHI site, the -R2 primer wil begin with a BglII site (AGATCT), unless the target has no BglII sites. If the target has both sites, the design program gives up and doesn't prepend a restriction site to the -R2 primer!
Predicted Tm was obtained using the Tm determination tool at the Virtual Genome Center.
| Primer ID | Predicted Tm | sequence |
|---|---|---|
| 1667T-R10 | 65.20 | GGCGGTGGTGGCGGCATGTTAAACGATTTTGCAGTACGGGTAGC |
| 1667T-R11 | 63.40 | GTTCTTCTCCTTTGCGCCCCTAGAAAATATCTCTTAGACTTTGGAAAGTTTTTGA |
Note: This was generated using the standard codon usage table; UGA codons in MP/MP genes will show up as terminators ("*")
ttaaacgattttgcagtacgggtagcaaagtcgtttagcaaggtttctgaagagaagaaa L N D F A V R V A K S F S K V S E E K K agtggtagtgacatccagggtgtttttggcattggtagtttagaaaatgcgctttacact S G S D I Q G V F G I G S L E N A L Y T gcatcatttgcagccggtggtggcgactataacaacttcttgtttaacattaaaaaaggt A S F A A G G G D Y N N F L F N I K K G cgcgctgattttagtaacttctttaaccacaattcaaaaactttccaaagtctaagagat R A D F S N F F N H N S K T F Q S L R D attttc I F
LNDFAVRVAKSFSKVSEEKKSGSDIQGVFGIGSLENALYTASFAAGGGDYNNFLFNIKKGRADFSNFFNHNSKTFQSLRD IF
This information was obtained using the Protein Parameters tool on the ExPASy Molecular Biology Server.
Number of amino acids: 82
Molecular weight: 9040.0
Theoretical pI: 9.11
Amino acid composition:
Ala (A) 7 8.5%
Arg (R) 3 3.7%
Asn (N) 8 9.8%
Asp (D) 5 6.1%
Cys (C) 0 0.0%
Gln (Q) 2 2.4%
Glu (E) 3 3.7%
Gly (G) 8 9.8%
His (H) 1 1.2%
Ile (I) 4 4.9%
Leu (L) 5 6.1%
Lys (K) 7 8.5%
Met (M) 0 0.0%
Phe (F) 11 13.4%
Pro (P) 0 0.0%
Ser (S) 10 12.2%
Thr (T) 2 2.4%
Trp (W) 0 0.0%
Tyr (Y) 2 2.4%
Val (V) 4 4.9%
Asx (B) 0 0.0%
Glx (Z) 0 0.0%
Xaa (X) 0 0.0%
Total number of negatively charged residues (Asp + Glu): 8
Total number of positively charged residues (Arg + Lys): 10
Atomic composition:
Carbon C 409
Hydrogen H 614
Nitrogen N 110
Oxygen O 123
Sulfur S 0
Formula: C409H614N110O123
Total number of atoms: 1256
Extinction coefficients:
Conditions: 6.0 M guanidium hydrochloride
0.02 M phosphate buffer
pH 6.5
Extinction coefficients are in units of M-1 cm-1 .
276 278 279 280 282
nm nm nm nm nm
Ext. coefficient 2900 2800 2690 2560 2400
Abs 0.1% (=1 g/l) 0.321 0.310 0.298 0.283 0.265
Estimated half-life:
The N-terminal of the sequence considered is L (Leu).
The estimated half-life is: 5.5 hours (mammalian reticulocytes, in vitro).
3 min (yeast, in vivo).
2 min (Escherichia coli, in vivo).
Instability index:
The instability index (II) is computed to be 24.95
This classifies the protein as stable.
Aliphatic index: 65.49
Grand average of hydropathicity (GRAVY): -0.305