|
|
This gene has the annotation "conserved hypothetical protein".
The target was selected as part of First domain set.
Available sections:
| Experiment | Result | User | Experiment Date |
|---|---|---|---|
| Selected | Done | jmc | 2004-03-22 |
| Cloned | Done | cshong | 2004-06-15 |
| Expression tested | Done | cshong | 2004-06-15 |
| Solubility tested | S | cshong | 2004-06-15 |
| Work stopped | uncertainty in predicting domain boundaries | jmc | 2005-02-25 |
| MP gene | log10(PSIBLAST E) | % identical | % coverage (of MP gene) |
|---|---|---|---|
| MP002 / MPN152 | -62.40 | 47.02 | 86.15 |
| MP007 / MPN147 | -56.30 | 44.10 | 100.00 |
| MP057 / MPN097 | -63.15 | 43.59 | 100.00 |
| MP336 / MPN506 | -65.00 | 51.28 | 100.00 |
| MP430 / MPN408 | -60.30 | 42.05 | 100.00 |
| MP472 / MPN364 | -63.05 | 45.64 | 100.00 |
| MP547 / MPN288 | -67.22 | 49.74 | 100.00 |
| MP551 / MPN284 | -65.00 | 50.26 | 100.00 |
| MP554 / MPN281 | -29.70 | 50.60 | 42.56 |
| MP631 / MPN200 | -60.10 | 46.15 | 100.00 |
| MP632 / MPN199 | -65.40 | 100.00 | 100.00 |
TTAAACGATTTTGCAGTACGGGTAGCAAAGTCGTTTAGCAAGGTTTCTGAAGAGAAGAAAAGTGGTAGTGACATCCAGGG TGTTTTTGGCATTGGTAGTTTAGAAAATGCGCTTTACACTGCATCATTTGCAGCCGGTGGTGGCGACTATAACAACTTCT TGTTTAACATTAAAAAAGGTCGCGCTGATTTTAGTAACTTCTTTAACCACAATTCAAAAACTTTCCAAAGTCTAAGAGAT ATTTTCAACAGCTTTAAGCCTTTAATTGACCAAAAGGGTTTAATTAGTAACAAACACTTTGATACTCCAGTGAATAATTA CGCTAAATTTCACCAATTGGCATTCTATGTATCATCGACAGCTCGCTTTCCTTACTCGTTTGCCAAAGATAATGTAAAAC GCTTAATTATTGGTAAACGCGAATTGGAAGTAAACCCTAAATCAATGTTTGCCATTAAGAAGGAAAACGGCAATAACGGT AACAGCAACCTCTTAGGTAAAGTTGCACTAGATAACAATAAATCTATTGAACTTTACGAAAATAATATTCCTAACGGTAA AACTGATGCCATCTTAATTAAGAAC
(195 codons) fields: [triplet] [frequency: per thousand] ([number]) UUU66.7( 13) UCU10.3( 2) UAU10.3( 2) UGU0.0( 0) UUC25.6( 5) UCC0.0( 0) UAC20.5( 4) UGC0.0( 0) UUA35.9( 7) UCA20.5( 4) UAA0.0( 0) UGA0.0( 0) UUG15.4( 3) UCG15.4( 3) UAG0.0( 0) UGG0.0( 0) CUU10.3( 2) CCU20.5( 4) CAU0.0( 0) CGU0.0( 0) CUC5.1( 1) CCC0.0( 0) CAC15.4( 3) CGC20.5( 4) CUA10.3( 2) CCA5.1( 1) CAA15.4( 3) CGA0.0( 0) CUG0.0( 0) CCG0.0( 0) CAG5.1( 1) CGG5.1( 1) AUU56.4( 11) ACU20.5( 4) AAU46.2( 9) AGU30.8( 6) AUC10.3( 2) ACC0.0( 0) AAC82.1( 16) AGC15.4( 3) AUA0.0( 0) ACA5.1( 1) AAA66.7( 13) AGA5.1( 1) AUG5.1( 1) ACG0.0( 0) AAG41.0( 8) AGG0.0( 0) GUU15.4( 3) GCU15.4( 3) GAU35.9( 7) GGU56.4( 11) GUC0.0( 0) GCC20.5( 4) GAC15.4( 3) GGC15.4( 3) GUA25.6( 5) GCA30.8( 6) GAA35.9( 7) GGA0.0( 0) GUG5.1( 1) GCG5.1( 1) GAG5.1( 1) GGG0.0( 0)
Note: These were generated using Hisao's algorithm, and do not take into account possible mispriming, self-complementarity, or requirements for mutations anywhere in the sequences. The -R1 primers are for the N-terminal end, and begin with an NdeI restriction site (CATATG). The -R2 primers are for the C-terminal end, and begin with a BamHI site (GGATCC) if the target has no other BamHI sites. If the target does have a BamHI site, the -R2 primer wil begin with a BglII site (AGATCT), unless the target has no BglII sites. If the target has both sites, the design program gives up and doesn't prepend a restriction site to the -R2 primer!
Predicted Tm was obtained using the Tm determination tool at the Virtual Genome Center.
| Primer ID | Predicted Tm | sequence |
|---|---|---|
| 1670T-R10 | 65.20 | GGCGGTGGTGGCGGCATGTTAAACGATTTTGCAGTACGGGTAGC |
| 1670T-R11 | 65.60 | GTTCTTCTCCTTTGCGCCCCTAGTTCTTAATTAAGATGGCATCAGTTTTACCG |
Note: This was generated using the standard codon usage table; UGA codons in MP/MP genes will show up as terminators ("*")
ttaaacgattttgcagtacgggtagcaaagtcgtttagcaaggtttctgaagagaagaaa L N D F A V R V A K S F S K V S E E K K agtggtagtgacatccagggtgtttttggcattggtagtttagaaaatgcgctttacact S G S D I Q G V F G I G S L E N A L Y T gcatcatttgcagccggtggtggcgactataacaacttcttgtttaacattaaaaaaggt A S F A A G G G D Y N N F L F N I K K G cgcgctgattttagtaacttctttaaccacaattcaaaaactttccaaagtctaagagat R A D F S N F F N H N S K T F Q S L R D attttcaacagctttaagcctttaattgaccaaaagggtttaattagtaacaaacacttt I F N S F K P L I D Q K G L I S N K H F gatactccagtgaataattacgctaaatttcaccaattggcattctatgtatcatcgaca D T P V N N Y A K F H Q L A F Y V S S T gctcgctttccttactcgtttgccaaagataatgtaaaacgcttaattattggtaaacgc A R F P Y S F A K D N V K R L I I G K R gaattggaagtaaaccctaaatcaatgtttgccattaagaaggaaaacggcaataacggt E L E V N P K S M F A I K K E N G N N G aacagcaacctcttaggtaaagttgcactagataacaataaatctattgaactttacgaa N S N L L G K V A L D N N K S I E L Y E aataatattcctaacggtaaaactgatgccatcttaattaagaac N N I P N G K T D A I L I K N
LNDFAVRVAKSFSKVSEEKKSGSDIQGVFGIGSLENALYTASFAAGGGDYNNFLFNIKKGRADFSNFFNHNSKTFQSLRD IFNSFKPLIDQKGLISNKHFDTPVNNYAKFHQLAFYVSSTARFPYSFAKDNVKRLIIGKRELEVNPKSMFAIKKENGNNG NSNLLGKVALDNNKSIELYENNIPNGKTDAILIKN
This information was obtained using the Protein Parameters tool on the ExPASy Molecular Biology Server.
Number of amino acids: 195
Molecular weight: 21779.5
Theoretical pI: 9.62
Amino acid composition:
Ala (A) 14 7.2%
Arg (R) 6 3.1%
Asn (N) 25 12.8%
Asp (D) 10 5.1%
Cys (C) 0 0.0%
Gln (Q) 4 2.1%
Glu (E) 8 4.1%
Gly (G) 14 7.2%
His (H) 3 1.5%
Ile (I) 13 6.7%
Leu (L) 15 7.7%
Lys (K) 21 10.8%
Met (M) 1 0.5%
Phe (F) 18 9.2%
Pro (P) 5 2.6%
Ser (S) 18 9.2%
Thr (T) 5 2.6%
Trp (W) 0 0.0%
Tyr (Y) 6 3.1%
Val (V) 9 4.6%
Asx (B) 0 0.0%
Glx (Z) 0 0.0%
Xaa (X) 0 0.0%
Total number of negatively charged residues (Asp + Glu): 18
Total number of positively charged residues (Arg + Lys): 27
Atomic composition:
Carbon C 983
Hydrogen H 1521
Nitrogen N 269
Oxygen O 290
Sulfur S 1
Formula: C983H1521N269O290S1
Total number of atoms: 3064
Extinction coefficients:
Conditions: 6.0 M guanidium hydrochloride
0.02 M phosphate buffer
pH 6.5
Extinction coefficients are in units of M-1 cm-1 .
276 278 279 280 282
nm nm nm nm nm
Ext. coefficient 8700 8400 8070 7680 7200
Abs 0.1% (=1 g/l) 0.399 0.386 0.371 0.353 0.331
Estimated half-life:
The N-terminal of the sequence considered is L (Leu).
The estimated half-life is: 5.5 hours (mammalian reticulocytes, in vitro).
3 min (yeast, in vivo).
2 min (Escherichia coli, in vivo).
Instability index:
The instability index (II) is computed to be 24.52
This classifies the protein as stable.
Aliphatic index: 76.56
Grand average of hydropathicity (GRAVY): -0.469