|
|
This gene has the annotation "conserved hypothetical protein".
The target was selected as part of First domain set.
Available sections:
| Experiment | Result | User | Experiment Date |
|---|---|---|---|
| Selected | Done | jmc | 2004-03-22 |
| Cloned | Done | cshong | 2004-06-15 |
| Expression tested | Done | cshong | 2004-06-15 |
| Work stopped | uncertainty in predicting domain boundaries | jmc | 2005-02-25 |
| MP gene | log10(PSIBLAST E) | % identical | % coverage (of MP gene) |
|---|---|---|---|
| MP002 / MPN152 | -45.30 | 76.24 | 100.00 |
| MP008 / MPN146 | -33.70 | 68.67 | 82.18 |
| MP057 / MPN097 | -44.70 | 77.23 | 100.00 |
| MP336 / MPN506 | -46.10 | 76.24 | 100.00 |
| MP430 / MPN408 | -35.40 | 51.49 | 100.00 |
| MP473 / MPN363 | -43.52 | 76.24 | 100.00 |
| MP547 / MPN288 | -45.52 | 76.24 | 100.00 |
| MP551 / MPN284 | -44.00 | 74.26 | 100.00 |
| MP554 / MPN281 | -45.40 | 100.00 | 100.00 |
| MP631 / MPN200 | -44.40 | 76.24 | 100.00 |
| MP632 / MPN199 | -32.52 | 50.50 | 100.00 |
ATGAAATTTAAGTATGGAACGGTTGTTTTGGGCAGTTTTTTAGGGCTTTCTGTGGTGTTAGCTGCCTGTGGTGCTCGTGG TAAATTTGACCAATTTGATGATGGCAAAATTAAGCTAGCATCATCCTTAACTTCCAAAGCAGCTGCCAATGCTTTACAAA CAATAATAGAGAAGTACAACATTGTCAAAAGCGGCAAGGATTACCCCATTGAAATTACCCAAATTGCTGGTGGTTATGAC GGCGGGCGGACTGATCTCCAAACCCGAGTTAGTGTTAAGGATAAAACGAACTTTTATAACCTT
(101 codons) fields: [triplet] [frequency: per thousand] ([number]) UUU49.5( 5) UCU9.9( 1) UAU29.7( 3) UGU9.9( 1) UUC0.0( 0) UCC19.8( 2) UAC19.8( 2) UGC0.0( 0) UUA39.6( 4) UCA9.9( 1) UAA0.0( 0) UGA0.0( 0) UUG9.9( 1) UCG0.0( 0) UAG0.0( 0) UGG0.0( 0) CUU19.8( 2) CCU0.0( 0) CAU0.0( 0) CGU9.9( 1) CUC9.9( 1) CCC9.9( 1) CAC0.0( 0) CGC0.0( 0) CUA9.9( 1) CCA0.0( 0) CAA39.6( 4) CGA9.9( 1) CUG0.0( 0) CCG0.0( 0) CAG0.0( 0) CGG9.9( 1) AUU49.5( 5) ACU19.8( 2) AAU9.9( 1) AGU19.8( 2) AUC0.0( 0) ACC19.8( 2) AAC29.7( 3) AGC9.9( 1) AUA19.8( 2) ACA9.9( 1) AAA59.4( 6) AGA0.0( 0) AUG9.9( 1) ACG19.8( 2) AAG49.5( 5) AGG0.0( 0) GUU39.6( 4) GCU49.5( 5) GAU49.5( 5) GGU39.6( 4) GUC9.9( 1) GCC19.8( 2) GAC19.8( 2) GGC39.6( 4) GUA0.0( 0) GCA19.8( 2) GAA9.9( 1) GGA9.9( 1) GUG19.8( 2) GCG0.0( 0) GAG9.9( 1) GGG19.8( 2)
Note: These were generated using Hisao's algorithm, and do not take into account possible mispriming, self-complementarity, or requirements for mutations anywhere in the sequences. The -R1 primers are for the N-terminal end, and begin with an NdeI restriction site (CATATG). The -R2 primers are for the C-terminal end, and begin with a BamHI site (GGATCC) if the target has no other BamHI sites. If the target does have a BamHI site, the -R2 primer wil begin with a BglII site (AGATCT), unless the target has no BglII sites. If the target has both sites, the design program gives up and doesn't prepend a restriction site to the -R2 primer!
Predicted Tm was obtained using the Tm determination tool at the Virtual Genome Center.
| Primer ID | Predicted Tm | sequence |
|---|---|---|
| 1675T-R10 | 63.00 | GGCGGTGGTGGCGGCATGATGAAATTTAAGTATGGAACGGTTGTTTT |
| 1675T-R11 | 63.30 | GTTCTTCTCCTTTGCGCCCCTAAAGGTTATAAAAGTTCGTTTTATCCTTAACACTAAC |
Note: This was generated using the standard codon usage table; UGA codons in MP/MP genes will show up as terminators ("*")
atgaaatttaagtatggaacggttgttttgggcagttttttagggctttctgtggtgtta M K F K Y G T V V L G S F L G L S V V L gctgcctgtggtgctcgtggtaaatttgaccaatttgatgatggcaaaattaagctagca A A C G A R G K F D Q F D D G K I K L A tcatccttaacttccaaagcagctgccaatgctttacaaacaataatagagaagtacaac S S L T S K A A A N A L Q T I I E K Y N attgtcaaaagcggcaaggattaccccattgaaattacccaaattgctggtggttatgac I V K S G K D Y P I E I T Q I A G G Y D ggcgggcggactgatctccaaacccgagttagtgttaaggataaaacgaacttttataac G G R T D L Q T R V S V K D K T N F Y N ctt L
MKFKYGTVVLGSFLGLSVVLAACGARGKFDQFDDGKIKLASSLTSKAAANALQTIIEKYNIVKSGKDYPIEITQIAGGYD GGRTDLQTRVSVKDKTNFYNL
This information was obtained using the Protein Parameters tool on the ExPASy Molecular Biology Server.
Number of amino acids: 101
Molecular weight: 10901.5
Theoretical pI: 9.41
Amino acid composition:
Ala (A) 9 8.9%
Arg (R) 3 3.0%
Asn (N) 4 4.0%
Asp (D) 7 6.9%
Cys (C) 1 1.0%
Gln (Q) 4 4.0%
Glu (E) 2 2.0%
Gly (G) 11 10.9%
His (H) 0 0.0%
Ile (I) 7 6.9%
Leu (L) 9 8.9%
Lys (K) 11 10.9%
Met (M) 1 1.0%
Phe (F) 5 5.0%
Pro (P) 1 1.0%
Ser (S) 7 6.9%
Thr (T) 7 6.9%
Trp (W) 0 0.0%
Tyr (Y) 5 5.0%
Val (V) 7 6.9%
Asx (B) 0 0.0%
Glx (Z) 0 0.0%
Xaa (X) 0 0.0%
Total number of negatively charged residues (Asp + Glu): 9
Total number of positively charged residues (Arg + Lys): 14
Atomic composition:
Carbon C 490
Hydrogen H 787
Nitrogen N 129
Oxygen O 147
Sulfur S 2
Formula: C490H787N129O147S2
Total number of atoms: 1555
Extinction coefficients:
Conditions: 6.0 M guanidium hydrochloride
0.02 M phosphate buffer
pH 6.5
Extinction coefficients are in units of M-1 cm-1 .
The first table lists values computed assuming ALL Cys
residues appear as half cystines, whereas the second table
assumes that NONE do.
276 278 279 280 282
nm nm nm nm nm
Ext. coefficient 7250 7000 6725 6400 6000
Abs 0.1% (=1 g/l) 0.665 0.642 0.617 0.587 0.550
276 278 279 280 282
nm nm nm nm nm
Ext. coefficient 7250 7000 6725 6400 6000
Abs 0.1% (=1 g/l) 0.665 0.642 0.617 0.587 0.550
Estimated half-life:
The N-terminal of the sequence considered is M (Met).
The estimated half-life is: 30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Instability index:
The instability index (II) is computed to be 31.80
This classifies the protein as stable.
Aliphatic index: 90.79
Grand average of hydropathicity (GRAVY): -0.091