Berkeley Structural Genomics Center

Target info for 1680T

This target is
Warning: mysql_fetch_object(): supplied argument is not a valid MySQL result resource in /home/httpd/strgen/r050111/status/common_db.php on line 537
MP000, gi number 13508027 from Mycoplasma pneumoniae.

This gene has the annotation "conserved hypothetical protein".

The target was selected as part of First domain set.

Available sections:


Experimental status of 1680T

Note: Dates prior to 10/24/01 may be inaccurate, due to conversion from a record-keeping system which tracked only the last experimental date, to a new system which keeps track of all dates. The user is the person who entered the data, not the person who did the experiment. This will also change in the future.

ExperimentResultUserExperiment Date
SelectedDonejmc2004-03-22
ClonedDonecshong2004-06-15
Expression testedDonecshong2004-06-15
Work stoppeduncertainty in predicting domain boundariesjmc2005-02-25

Back to Top


Potential MP Homologues of 1680T

MP genelog10(PSIBLAST E)% identical% coverage (of MP gene)
MP002 / MPN152-56.5264.6099.38
MP007 / MPN147-56.4054.32100.00
MP056 / MPN098-9.0577.7816.67
MP057 / MPN097-6.1057.6916.05
MP336 / MPN506-60.4066.05100.00
MP430 / MPN408-56.7047.53100.00
MP472 / MPN364-56.4062.35100.00
MP547 / MPN288-64.00100.00100.00
MP551 / MPN284-56.1062.1199.38
MP553 / MPN282-52.0055.56100.00
MP631 / MPN200-54.0557.41100.00
MP632 / MPN199-42.0533.33100.00

Back to Top


1680T DNA sequence

AAAACCATTTACCTTTACAAAAGTCAAATTCCATCAGACAAAACAGAAGGCGAAAATGCCATCTTAATCAAAGAACAAAA
CGTTATTAATCAGCTAGAACAAGCAGCTAAAAAAGATGAAAAAGGAGAGACTGTTACAAACAAAGTTGCATCATTAGAAA
CCAAAGCTGCTAATGCCAAAAAGGATAGTAGTAAAACCATTATTGGTTACACCACAACTGATAATGTTCATGAAGACGGT
AAAAACATTTTCAAAATTAACAAACTCAAAACTGAAGACTATGATCGTAAGATTATTGTCGGTGCCACTGAAGAAGTGTT
AGAGCAATCTAGCACATTACAAAGTGATGAAGCAATTGTGTTACCAGCTCCTGGTAAGTATCAAAGTGGTGACGCTAAGA
AAGTAACCATCACCCAAGGTCCTAATATCATTGGCATTCACGCTAACGAAAAGGAAAACGCCGAAACGCAAAAGTTTGTT
AACTGG

Back to Top


1680T Codon Usage

(162 codons)
fields: [triplet] [frequency: per thousand] ([number])

UUU6.2(   1)  UCU6.2(   1)  UAU12.3(   2)  UGU0.0(   0)  
UUC6.2(   1)  UCC0.0(   0)  UAC18.5(   3)  UGC0.0(   0)  
UUA30.9(   5)  UCA12.3(   2)  UAA0.0(   0)  UGA0.0(   0)  
UUG0.0(   0)  UCG0.0(   0)  UAG0.0(   0)  UGG6.2(   1)  

CUU6.2(   1)  CCU12.3(   2)  CAU6.2(   1)  CGU6.2(   1)  
CUC6.2(   1)  CCC0.0(   0)  CAC6.2(   1)  CGC0.0(   0)  
CUA6.2(   1)  CCA12.3(   2)  CAA49.4(   8)  CGA0.0(   0)  
CUG0.0(   0)  CCG0.0(   0)  CAG6.2(   1)  CGG0.0(   0)  

AUU74.1(  12)  ACU24.7(   4)  AAU30.9(   5)  AGU30.9(   5)  
AUC24.7(   4)  ACC37.0(   6)  AAC43.2(   7)  AGC6.2(   1)  
AUA0.0(   0)  ACA24.7(   4)  AAA98.8(  16)  AGA0.0(   0)  
AUG0.0(   0)  ACG6.2(   1)  AAG37.0(   6)  AGG0.0(   0)  

GUU30.9(   5)  GCU37.0(   6)  GAU30.9(   5)  GGU37.0(   6)  
GUC6.2(   1)  GCC24.7(   4)  GAC24.7(   4)  GGC12.3(   2)  
GUA6.2(   1)  GCA18.5(   3)  GAA86.4(  14)  GGA6.2(   1)  
GUG12.3(   2)  GCG0.0(   0)  GAG12.3(   2)  GGG0.0(   0)  

Back to Top


1680T Potential Cloning Problems

No UGA codons or (bad) restriction sites!

Back to Top


1680T Automatically Selected Primers

Note: These were generated using Hisao's algorithm, and do not take into account possible mispriming, self-complementarity, or requirements for mutations anywhere in the sequences. The -R1 primers are for the N-terminal end, and begin with an NdeI restriction site (CATATG). The -R2 primers are for the C-terminal end, and begin with a BamHI site (GGATCC) if the target has no other BamHI sites. If the target does have a BamHI site, the -R2 primer wil begin with a BglII site (AGATCT), unless the target has no BglII sites. If the target has both sites, the design program gives up and doesn't prepend a restriction site to the -R2 primer!

Predicted Tm was obtained using the Tm determination tool at the Virtual Genome Center.

Primer IDPredicted Tmsequence
1680T-R1065.00GGCGGTGGTGGCGGCATGAAAACCATTTACCTTTACAAAAGTCAAATTCC
1680T-R1164.80GTTCTTCTCCTTTGCGCCCCTACCAGTTAACAAACTTTTGCGTTTCG

Back to Top


1680T Translation

Note: This was generated using the standard codon usage table; UGA codons in MP/MP genes will show up as terminators ("*")

aaaaccatttacctttacaaaagtcaaattccatcagacaaaacagaaggcgaaaatgcc
 K  T  I  Y  L  Y  K  S  Q  I  P  S  D  K  T  E  G  E  N  A 
atcttaatcaaagaacaaaacgttattaatcagctagaacaagcagctaaaaaagatgaa
 I  L  I  K  E  Q  N  V  I  N  Q  L  E  Q  A  A  K  K  D  E 
aaaggagagactgttacaaacaaagttgcatcattagaaaccaaagctgctaatgccaaa
 K  G  E  T  V  T  N  K  V  A  S  L  E  T  K  A  A  N  A  K 
aaggatagtagtaaaaccattattggttacaccacaactgataatgttcatgaagacggt
 K  D  S  S  K  T  I  I  G  Y  T  T  T  D  N  V  H  E  D  G 
aaaaacattttcaaaattaacaaactcaaaactgaagactatgatcgtaagattattgtc
 K  N  I  F  K  I  N  K  L  K  T  E  D  Y  D  R  K  I  I  V 
ggtgccactgaagaagtgttagagcaatctagcacattacaaagtgatgaagcaattgtg
 G  A  T  E  E  V  L  E  Q  S  S  T  L  Q  S  D  E  A  I  V 
ttaccagctcctggtaagtatcaaagtggtgacgctaagaaagtaaccatcacccaaggt
 L  P  A  P  G  K  Y  Q  S  G  D  A  K  K  V  T  I  T  Q  G 
cctaatatcattggcattcacgctaacgaaaaggaaaacgccgaaacgcaaaagtttgtt
 P  N  I  I  G  I  H  A  N  E  K  E  N  A  E  T  Q  K  F  V 
aactgg
 N  W 

Back to Top


1680T AA Sequence

KTIYLYKSQIPSDKTEGENAILIKEQNVINQLEQAAKKDEKGETVTNKVASLETKAANAKKDSSKTIIGYTTTDNVHEDG
KNIFKINKLKTEDYDRKIIVGATEEVLEQSSTLQSDEAIVLPAPGKYQSGDAKKVTITQGPNIIGIHANEKENAETQKFV
NW

Back to Top


1680T Protein Parameters

This information was obtained using the Protein Parameters tool on the ExPASy Molecular Biology Server.

Number of amino acids: 162

Molecular weight: 17923.0

Theoretical pI: 5.81

Amino acid composition:

Ala (A)  13	  8.0%
Arg (R)   1	  0.6%
Asn (N)  12	  7.4%
Asp (D)   9	  5.6%
Cys (C)   0	  0.0%
Gln (Q)   9	  5.6%
Glu (E)  16	  9.9%
Gly (G)   9	  5.6%
His (H)   2	  1.2%
Ile (I)  16	  9.9%
Leu (L)   8	  4.9%
Lys (K)  22	 13.6%
Met (M)   0	  0.0%
Phe (F)   2	  1.2%
Pro (P)   4	  2.5%
Ser (S)   9	  5.6%
Thr (T)  15	  9.3%
Trp (W)   1	  0.6%
Tyr (Y)   5	  3.1%
Val (V)   9	  5.6%

Asx (B)   0	  0.0%
Glx (Z)   0	  0.0%
Xaa (X)   0	  0.0%

Total number of negatively charged residues (Asp + Glu): 25
Total number of positively charged residues (Arg + Lys): 23

Atomic composition:

Carbon      C	       786
Hydrogen    H	      1281
Nitrogen    N	       213
Oxygen      O	       263
Sulfur      S	         0

Formula: C786H1281N213O263
Total number of atoms: 2543

Extinction coefficients:

Conditions: 6.0 M guanidium hydrochloride
            0.02 M phosphate buffer
            pH 6.5

Extinction coefficients are in units of  M-1 cm-1 .

                      276     278     279     280     282
                       nm      nm      nm      nm      nm
Ext. coefficient    12650   12600   12385   12090   11600
Abs 0.1% (=1 g/l)   0.706   0.703   0.691   0.675   0.647


Estimated half-life:

The N-terminal of the sequence considered is K (Lys).

The estimated half-life is: 1.3 hours (mammalian reticulocytes, in vitro).
                            3 min (yeast, in vivo).
                            3 min (Escherichia coli, in vivo).


Instability index:

The instability index (II) is computed to be 36.94
This classifies the protein as stable.



Aliphatic index: 81.91

Grand average of hydropathicity (GRAVY): -0.763

Back to Top