|
|
This gene has the annotation "conserved hypothetical protein".
The target was selected as part of First domain set.
Available sections:
| Experiment | Result | User | Experiment Date |
|---|---|---|---|
| Selected | Done | jmc | 2004-03-22 |
| Cloned | Done | cshong | 2004-06-15 |
| Expression tested | Done | cshong | 2004-06-15 |
| Work stopped | uncertainty in predicting domain boundaries | jmc | 2005-02-25 |
| MP gene | log10(PSIBLAST E) | % identical | % coverage (of MP gene) |
|---|---|---|---|
| MP002 / MPN152 | -56.52 | 64.60 | 99.38 |
| MP007 / MPN147 | -56.40 | 54.32 | 100.00 |
| MP056 / MPN098 | -9.05 | 77.78 | 16.67 |
| MP057 / MPN097 | -6.10 | 57.69 | 16.05 |
| MP336 / MPN506 | -60.40 | 66.05 | 100.00 |
| MP430 / MPN408 | -56.70 | 47.53 | 100.00 |
| MP472 / MPN364 | -56.40 | 62.35 | 100.00 |
| MP547 / MPN288 | -64.00 | 100.00 | 100.00 |
| MP551 / MPN284 | -56.10 | 62.11 | 99.38 |
| MP553 / MPN282 | -52.00 | 55.56 | 100.00 |
| MP631 / MPN200 | -54.05 | 57.41 | 100.00 |
| MP632 / MPN199 | -42.05 | 33.33 | 100.00 |
AAAACCATTTACCTTTACAAAAGTCAAATTCCATCAGACAAAACAGAAGGCGAAAATGCCATCTTAATCAAAGAACAAAA CGTTATTAATCAGCTAGAACAAGCAGCTAAAAAAGATGAAAAAGGAGAGACTGTTACAAACAAAGTTGCATCATTAGAAA CCAAAGCTGCTAATGCCAAAAAGGATAGTAGTAAAACCATTATTGGTTACACCACAACTGATAATGTTCATGAAGACGGT AAAAACATTTTCAAAATTAACAAACTCAAAACTGAAGACTATGATCGTAAGATTATTGTCGGTGCCACTGAAGAAGTGTT AGAGCAATCTAGCACATTACAAAGTGATGAAGCAATTGTGTTACCAGCTCCTGGTAAGTATCAAAGTGGTGACGCTAAGA AAGTAACCATCACCCAAGGTCCTAATATCATTGGCATTCACGCTAACGAAAAGGAAAACGCCGAAACGCAAAAGTTTGTT AACTGG
(162 codons) fields: [triplet] [frequency: per thousand] ([number]) UUU6.2( 1) UCU6.2( 1) UAU12.3( 2) UGU0.0( 0) UUC6.2( 1) UCC0.0( 0) UAC18.5( 3) UGC0.0( 0) UUA30.9( 5) UCA12.3( 2) UAA0.0( 0) UGA0.0( 0) UUG0.0( 0) UCG0.0( 0) UAG0.0( 0) UGG6.2( 1) CUU6.2( 1) CCU12.3( 2) CAU6.2( 1) CGU6.2( 1) CUC6.2( 1) CCC0.0( 0) CAC6.2( 1) CGC0.0( 0) CUA6.2( 1) CCA12.3( 2) CAA49.4( 8) CGA0.0( 0) CUG0.0( 0) CCG0.0( 0) CAG6.2( 1) CGG0.0( 0) AUU74.1( 12) ACU24.7( 4) AAU30.9( 5) AGU30.9( 5) AUC24.7( 4) ACC37.0( 6) AAC43.2( 7) AGC6.2( 1) AUA0.0( 0) ACA24.7( 4) AAA98.8( 16) AGA0.0( 0) AUG0.0( 0) ACG6.2( 1) AAG37.0( 6) AGG0.0( 0) GUU30.9( 5) GCU37.0( 6) GAU30.9( 5) GGU37.0( 6) GUC6.2( 1) GCC24.7( 4) GAC24.7( 4) GGC12.3( 2) GUA6.2( 1) GCA18.5( 3) GAA86.4( 14) GGA6.2( 1) GUG12.3( 2) GCG0.0( 0) GAG12.3( 2) GGG0.0( 0)
Note: These were generated using Hisao's algorithm, and do not take into account possible mispriming, self-complementarity, or requirements for mutations anywhere in the sequences. The -R1 primers are for the N-terminal end, and begin with an NdeI restriction site (CATATG). The -R2 primers are for the C-terminal end, and begin with a BamHI site (GGATCC) if the target has no other BamHI sites. If the target does have a BamHI site, the -R2 primer wil begin with a BglII site (AGATCT), unless the target has no BglII sites. If the target has both sites, the design program gives up and doesn't prepend a restriction site to the -R2 primer!
Predicted Tm was obtained using the Tm determination tool at the Virtual Genome Center.
| Primer ID | Predicted Tm | sequence |
|---|---|---|
| 1680T-R10 | 65.00 | GGCGGTGGTGGCGGCATGAAAACCATTTACCTTTACAAAAGTCAAATTCC |
| 1680T-R11 | 64.80 | GTTCTTCTCCTTTGCGCCCCTACCAGTTAACAAACTTTTGCGTTTCG |
Note: This was generated using the standard codon usage table; UGA codons in MP/MP genes will show up as terminators ("*")
aaaaccatttacctttacaaaagtcaaattccatcagacaaaacagaaggcgaaaatgcc K T I Y L Y K S Q I P S D K T E G E N A atcttaatcaaagaacaaaacgttattaatcagctagaacaagcagctaaaaaagatgaa I L I K E Q N V I N Q L E Q A A K K D E aaaggagagactgttacaaacaaagttgcatcattagaaaccaaagctgctaatgccaaa K G E T V T N K V A S L E T K A A N A K aaggatagtagtaaaaccattattggttacaccacaactgataatgttcatgaagacggt K D S S K T I I G Y T T T D N V H E D G aaaaacattttcaaaattaacaaactcaaaactgaagactatgatcgtaagattattgtc K N I F K I N K L K T E D Y D R K I I V ggtgccactgaagaagtgttagagcaatctagcacattacaaagtgatgaagcaattgtg G A T E E V L E Q S S T L Q S D E A I V ttaccagctcctggtaagtatcaaagtggtgacgctaagaaagtaaccatcacccaaggt L P A P G K Y Q S G D A K K V T I T Q G cctaatatcattggcattcacgctaacgaaaaggaaaacgccgaaacgcaaaagtttgtt P N I I G I H A N E K E N A E T Q K F V aactgg N W
KTIYLYKSQIPSDKTEGENAILIKEQNVINQLEQAAKKDEKGETVTNKVASLETKAANAKKDSSKTIIGYTTTDNVHEDG KNIFKINKLKTEDYDRKIIVGATEEVLEQSSTLQSDEAIVLPAPGKYQSGDAKKVTITQGPNIIGIHANEKENAETQKFV NW
This information was obtained using the Protein Parameters tool on the ExPASy Molecular Biology Server.
Number of amino acids: 162
Molecular weight: 17923.0
Theoretical pI: 5.81
Amino acid composition:
Ala (A) 13 8.0%
Arg (R) 1 0.6%
Asn (N) 12 7.4%
Asp (D) 9 5.6%
Cys (C) 0 0.0%
Gln (Q) 9 5.6%
Glu (E) 16 9.9%
Gly (G) 9 5.6%
His (H) 2 1.2%
Ile (I) 16 9.9%
Leu (L) 8 4.9%
Lys (K) 22 13.6%
Met (M) 0 0.0%
Phe (F) 2 1.2%
Pro (P) 4 2.5%
Ser (S) 9 5.6%
Thr (T) 15 9.3%
Trp (W) 1 0.6%
Tyr (Y) 5 3.1%
Val (V) 9 5.6%
Asx (B) 0 0.0%
Glx (Z) 0 0.0%
Xaa (X) 0 0.0%
Total number of negatively charged residues (Asp + Glu): 25
Total number of positively charged residues (Arg + Lys): 23
Atomic composition:
Carbon C 786
Hydrogen H 1281
Nitrogen N 213
Oxygen O 263
Sulfur S 0
Formula: C786H1281N213O263
Total number of atoms: 2543
Extinction coefficients:
Conditions: 6.0 M guanidium hydrochloride
0.02 M phosphate buffer
pH 6.5
Extinction coefficients are in units of M-1 cm-1 .
276 278 279 280 282
nm nm nm nm nm
Ext. coefficient 12650 12600 12385 12090 11600
Abs 0.1% (=1 g/l) 0.706 0.703 0.691 0.675 0.647
Estimated half-life:
The N-terminal of the sequence considered is K (Lys).
The estimated half-life is: 1.3 hours (mammalian reticulocytes, in vitro).
3 min (yeast, in vivo).
3 min (Escherichia coli, in vivo).
Instability index:
The instability index (II) is computed to be 36.94
This classifies the protein as stable.
Aliphatic index: 81.91
Grand average of hydropathicity (GRAVY): -0.763