Berkeley Structural Genomics Center

Target info for 1689T

This target is
Warning: mysql_fetch_object(): supplied argument is not a valid MySQL result resource in /home/httpd/strgen/r050111/status/common_db.php on line 537
MP000, gi number 13508147 from Mycoplasma pneumoniae.

This gene has the annotation "conserved hypothetical protein".

The target was selected as part of First domain set.

Available sections:


Experimental status of 1689T

Note: Dates prior to 10/24/01 may be inaccurate, due to conversion from a record-keeping system which tracked only the last experimental date, to a new system which keeps track of all dates. The user is the person who entered the data, not the person who did the experiment. This will also change in the future.

ExperimentResultUserExperiment Date
SelectedDonejmc2004-03-22
ClonedDonecshong2004-06-15
Expression testedDonecshong2004-06-15
Solubility testedIcshong2004-06-15
Work stoppeduncertainty in predicting domain boundariesjmc2005-02-25

Back to Top


Potential MP Homologues of 1689T

MP genelog10(PSIBLAST E)% identical% coverage (of MP gene)
MP002 / MPN152-61.5249.3799.37
MP007 / MPN147-56.5253.46100.00
MP056 / MPN098-9.5262.9616.98
MP057 / MPN097-7.0542.3116.35
MP336 / MPN506-61.0546.54100.00
MP430 / MPN408-64.00100.00100.00
MP472 / MPN364-59.5248.43100.00
MP547 / MPN288-62.3048.43100.00
MP551 / MPN284-61.1048.7399.37
MP553 / MPN282-55.1047.80100.00
MP631 / MPN200-58.3045.91100.00
MP632 / MPN199-43.7044.03100.00

Back to Top


1689T DNA sequence

GAAACGATTGAGCTTTACAAAAGCAGCGTTCCTAGTGGTAAAGAGGCGGGTAAAAATGCGCTTGCTATTACCAATCAACA
ACTAATTTCGGCTTTAGAAAATGCTGCAAAAGATAATAAAACCTCCCAACCACAAGCACGATCACTTACAGCTTCTGATC
AAGTTCAAATTACACAAAGTTCAGATAAGGTTATTGGTTACATCACCACATCTAATTTGGACATTGACAACAACAATACC
TTTGATGTTGGTAAGTTAAACGGTGATAAGTCAACCAGCAAAATCATTGTTAACGCTACTTTAAAAACCTTAAACAAGAT
CAACACCTTGCAAAGCGAAGAGGGCATTATTCTGCCCCATCCACAAAAATATAAGAGTACTGATCCACAAGCTGTCGCTA
CCGTTCAGGGTCCAAGTATTATTGGTGTTCATGCTAACGCTAAGGAAAACGCTGAAACCCAAAAATTTATCAACTGG

Back to Top


1689T Codon Usage

(159 codons)
fields: [triplet] [frequency: per thousand] ([number])

UUU12.6(   2)  UCU12.6(   2)  UAU6.3(   1)  UGU0.0(   0)  
UUC0.0(   0)  UCC6.3(   1)  UAC12.6(   2)  UGC0.0(   0)  
UUA25.2(   4)  UCA18.9(   3)  UAA0.0(   0)  UGA0.0(   0)  
UUG12.6(   2)  UCG6.3(   1)  UAG0.0(   0)  UGG6.3(   1)  

CUU18.9(   3)  CCU6.3(   1)  CAU12.6(   2)  CGU0.0(   0)  
CUC0.0(   0)  CCC6.3(   1)  CAC0.0(   0)  CGC0.0(   0)  
CUA6.3(   1)  CCA25.2(   4)  CAA69.2(  11)  CGA6.3(   1)  
CUG6.3(   1)  CCG0.0(   0)  CAG6.3(   1)  CGG0.0(   0)  

AUU69.2(  11)  ACU12.6(   2)  AAU37.7(   6)  AGU25.2(   4)  
AUC25.2(   4)  ACC56.6(   9)  AAC56.6(   9)  AGC25.2(   4)  
AUA0.0(   0)  ACA18.9(   3)  AAA56.6(   9)  AGA0.0(   0)  
AUG0.0(   0)  ACG6.3(   1)  AAG37.7(   6)  AGG0.0(   0)  

GUU44.0(   7)  GCU62.9(  10)  GAU37.7(   6)  GGU44.0(   7)  
GUC6.3(   1)  GCC0.0(   0)  GAC12.6(   2)  GGC6.3(   1)  
GUA0.0(   0)  GCA12.6(   2)  GAA31.4(   5)  GGA0.0(   0)  
GUG0.0(   0)  GCG12.6(   2)  GAG18.9(   3)  GGG0.0(   0)  

Back to Top


1689T Potential Cloning Problems

No UGA codons.
1 restriction site(s) found.

Details (problem DNA region is in upper case, with the key on the line below):

Key:

gaaacgattgagctttacaaaagcagcgttcctagtggtaaagaggcgggtaaaaatgcg
                                                            
cttgctattaccaatcaacaactaatttcggctttagaaaatgctgcaaaagataataaa
                                                            
acctcccaaccacaagcacgatcacttacagcttcTGATCAagttcaaattacacaaagt
                                   3                        
tcagataaggttattggttacatcaccacatctaatttggacattgacaacaacaatacc
                                                            
tttgatgttggtaagttaaacggtgataagtcaaccagcaaaatcattgttaacgctact
                                                            
ttaaaaaccttaaacaagatcaacaccttgcaaagcgaagagggcattattctgccccat
                                                            
ccacaaaaatataagagtactgatccacaagctgtcgctaccgttcagggtccaagtatt
                                                            
attggtgttcatgctaacgctaaggaaaacgctgaaacccaaaaatttatcaactgg
                                                         

Back to Top


1689T Automatically Selected Primers

Note: These were generated using Hisao's algorithm, and do not take into account possible mispriming, self-complementarity, or requirements for mutations anywhere in the sequences. The -R1 primers are for the N-terminal end, and begin with an NdeI restriction site (CATATG). The -R2 primers are for the C-terminal end, and begin with a BamHI site (GGATCC) if the target has no other BamHI sites. If the target does have a BamHI site, the -R2 primer wil begin with a BglII site (AGATCT), unless the target has no BglII sites. If the target has both sites, the design program gives up and doesn't prepend a restriction site to the -R2 primer!

Predicted Tm was obtained using the Tm determination tool at the Virtual Genome Center.

Primer IDPredicted Tmsequence
1689T-R1063.50GGCGGTGGTGGCGGCATGGAAACGATTGAGCTTTACAAAAGCAG
1689T-R1165.60GTTCTTCTCCTTTGCGCCCCTACCAGTTGATAAATTTTTGGGTTTCAGC

Back to Top


1689T Translation

Note: This was generated using the standard codon usage table; UGA codons in MP/MP genes will show up as terminators ("*")

gaaacgattgagctttacaaaagcagcgttcctagtggtaaagaggcgggtaaaaatgcg
 E  T  I  E  L  Y  K  S  S  V  P  S  G  K  E  A  G  K  N  A 
cttgctattaccaatcaacaactaatttcggctttagaaaatgctgcaaaagataataaa
 L  A  I  T  N  Q  Q  L  I  S  A  L  E  N  A  A  K  D  N  K 
acctcccaaccacaagcacgatcacttacagcttctgatcaagttcaaattacacaaagt
 T  S  Q  P  Q  A  R  S  L  T  A  S  D  Q  V  Q  I  T  Q  S 
tcagataaggttattggttacatcaccacatctaatttggacattgacaacaacaatacc
 S  D  K  V  I  G  Y  I  T  T  S  N  L  D  I  D  N  N  N  T 
tttgatgttggtaagttaaacggtgataagtcaaccagcaaaatcattgttaacgctact
 F  D  V  G  K  L  N  G  D  K  S  T  S  K  I  I  V  N  A  T 
ttaaaaaccttaaacaagatcaacaccttgcaaagcgaagagggcattattctgccccat
 L  K  T  L  N  K  I  N  T  L  Q  S  E  E  G  I  I  L  P  H 
ccacaaaaatataagagtactgatccacaagctgtcgctaccgttcagggtccaagtatt
 P  Q  K  Y  K  S  T  D  P  Q  A  V  A  T  V  Q  G  P  S  I 
attggtgttcatgctaacgctaaggaaaacgctgaaacccaaaaatttatcaactgg
 I  G  V  H  A  N  A  K  E  N  A  E  T  Q  K  F  I  N  W 

Back to Top


1689T AA Sequence

ETIELYKSSVPSGKEAGKNALAITNQQLISALENAAKDNKTSQPQARSLTASDQVQITQSSDKVIGYITTSNLDIDNNNT
FDVGKLNGDKSTSKIIVNATLKTLNKINTLQSEEGIILPHPQKYKSTDPQAVATVQGPSIIGVHANAKENAETQKFINW

Back to Top


1689T Protein Parameters

This information was obtained using the Protein Parameters tool on the ExPASy Molecular Biology Server.

Number of amino acids: 159

Molecular weight: 17136.1

Theoretical pI: 7.03

Amino acid composition:

Ala (A)  14	  8.8%
Arg (R)   1	  0.6%
Asn (N)  15	  9.4%
Asp (D)   8	  5.0%
Cys (C)   0	  0.0%
Gln (Q)  12	  7.5%
Glu (E)   8	  5.0%
Gly (G)   8	  5.0%
His (H)   2	  1.3%
Ile (I)  15	  9.4%
Leu (L)  11	  6.9%
Lys (K)  15	  9.4%
Met (M)   0	  0.0%
Phe (F)   2	  1.3%
Pro (P)   6	  3.8%
Ser (S)  15	  9.4%
Thr (T)  15	  9.4%
Trp (W)   1	  0.6%
Tyr (Y)   3	  1.9%
Val (V)   8	  5.0%

Asx (B)   0	  0.0%
Glx (Z)   0	  0.0%
Xaa (X)   0	  0.0%

Total number of negatively charged residues (Asp + Glu): 16
Total number of positively charged residues (Arg + Lys): 16

Atomic composition:

Carbon      C	       745
Hydrogen    H	      1219
Nitrogen    N	       209
Oxygen      O	       252
Sulfur      S	         0

Formula: C745H1219N209O252
Total number of atoms: 2425

Extinction coefficients:

Conditions: 6.0 M guanidium hydrochloride
            0.02 M phosphate buffer
            pH 6.5

Extinction coefficients are in units of  M-1 cm-1 .

                      276     278     279     280     282
                       nm      nm      nm      nm      nm
Ext. coefficient     9750    9800    9695    9530    9200
Abs 0.1% (=1 g/l)   0.569   0.572   0.566   0.556   0.537


Estimated half-life:

The N-terminal of the sequence considered is E (Glu).

The estimated half-life is: 1 hours (mammalian reticulocytes, in vitro).
                            30 min (yeast, in vivo).
                            >10 hours (Escherichia coli, in vivo).


Instability index:

The instability index (II) is computed to be 33.42
This classifies the protein as stable.



Aliphatic index: 87.17

Grand average of hydropathicity (GRAVY): -0.543

Back to Top