|
|
This gene has the annotation "conserved hypothetical protein".
The target was selected as part of First domain set.
Available sections:
| Experiment | Result | User | Experiment Date |
|---|---|---|---|
| Selected | Done | jmc | 2004-03-22 |
| Cloned | Done | cshong | 2004-06-15 |
| Expression tested | Done | cshong | 2004-06-15 |
| Solubility tested | I | cshong | 2004-06-15 |
| Work stopped | uncertainty in predicting domain boundaries | jmc | 2005-02-25 |
| MP gene | log10(PSIBLAST E) | % identical | % coverage (of MP gene) |
|---|---|---|---|
| MP002 / MPN152 | -61.52 | 49.37 | 99.37 |
| MP007 / MPN147 | -56.52 | 53.46 | 100.00 |
| MP056 / MPN098 | -9.52 | 62.96 | 16.98 |
| MP057 / MPN097 | -7.05 | 42.31 | 16.35 |
| MP336 / MPN506 | -61.05 | 46.54 | 100.00 |
| MP430 / MPN408 | -64.00 | 100.00 | 100.00 |
| MP472 / MPN364 | -59.52 | 48.43 | 100.00 |
| MP547 / MPN288 | -62.30 | 48.43 | 100.00 |
| MP551 / MPN284 | -61.10 | 48.73 | 99.37 |
| MP553 / MPN282 | -55.10 | 47.80 | 100.00 |
| MP631 / MPN200 | -58.30 | 45.91 | 100.00 |
| MP632 / MPN199 | -43.70 | 44.03 | 100.00 |
GAAACGATTGAGCTTTACAAAAGCAGCGTTCCTAGTGGTAAAGAGGCGGGTAAAAATGCGCTTGCTATTACCAATCAACA ACTAATTTCGGCTTTAGAAAATGCTGCAAAAGATAATAAAACCTCCCAACCACAAGCACGATCACTTACAGCTTCTGATC AAGTTCAAATTACACAAAGTTCAGATAAGGTTATTGGTTACATCACCACATCTAATTTGGACATTGACAACAACAATACC TTTGATGTTGGTAAGTTAAACGGTGATAAGTCAACCAGCAAAATCATTGTTAACGCTACTTTAAAAACCTTAAACAAGAT CAACACCTTGCAAAGCGAAGAGGGCATTATTCTGCCCCATCCACAAAAATATAAGAGTACTGATCCACAAGCTGTCGCTA CCGTTCAGGGTCCAAGTATTATTGGTGTTCATGCTAACGCTAAGGAAAACGCTGAAACCCAAAAATTTATCAACTGG
(159 codons) fields: [triplet] [frequency: per thousand] ([number]) UUU12.6( 2) UCU12.6( 2) UAU6.3( 1) UGU0.0( 0) UUC0.0( 0) UCC6.3( 1) UAC12.6( 2) UGC0.0( 0) UUA25.2( 4) UCA18.9( 3) UAA0.0( 0) UGA0.0( 0) UUG12.6( 2) UCG6.3( 1) UAG0.0( 0) UGG6.3( 1) CUU18.9( 3) CCU6.3( 1) CAU12.6( 2) CGU0.0( 0) CUC0.0( 0) CCC6.3( 1) CAC0.0( 0) CGC0.0( 0) CUA6.3( 1) CCA25.2( 4) CAA69.2( 11) CGA6.3( 1) CUG6.3( 1) CCG0.0( 0) CAG6.3( 1) CGG0.0( 0) AUU69.2( 11) ACU12.6( 2) AAU37.7( 6) AGU25.2( 4) AUC25.2( 4) ACC56.6( 9) AAC56.6( 9) AGC25.2( 4) AUA0.0( 0) ACA18.9( 3) AAA56.6( 9) AGA0.0( 0) AUG0.0( 0) ACG6.3( 1) AAG37.7( 6) AGG0.0( 0) GUU44.0( 7) GCU62.9( 10) GAU37.7( 6) GGU44.0( 7) GUC6.3( 1) GCC0.0( 0) GAC12.6( 2) GGC6.3( 1) GUA0.0( 0) GCA12.6( 2) GAA31.4( 5) GGA0.0( 0) GUG0.0( 0) GCG12.6( 2) GAG18.9( 3) GGG0.0( 0)
Details (problem DNA region is in upper case, with the key on the line below):
Key:
gaaacgattgagctttacaaaagcagcgttcctagtggtaaagaggcgggtaaaaatgcg
cttgctattaccaatcaacaactaatttcggctttagaaaatgctgcaaaagataataaa
acctcccaaccacaagcacgatcacttacagcttcTGATCAagttcaaattacacaaagt
3
tcagataaggttattggttacatcaccacatctaatttggacattgacaacaacaatacc
tttgatgttggtaagttaaacggtgataagtcaaccagcaaaatcattgttaacgctact
ttaaaaaccttaaacaagatcaacaccttgcaaagcgaagagggcattattctgccccat
ccacaaaaatataagagtactgatccacaagctgtcgctaccgttcagggtccaagtatt
attggtgttcatgctaacgctaaggaaaacgctgaaacccaaaaatttatcaactgg
Note: These were generated using Hisao's algorithm, and do not take into account possible mispriming, self-complementarity, or requirements for mutations anywhere in the sequences. The -R1 primers are for the N-terminal end, and begin with an NdeI restriction site (CATATG). The -R2 primers are for the C-terminal end, and begin with a BamHI site (GGATCC) if the target has no other BamHI sites. If the target does have a BamHI site, the -R2 primer wil begin with a BglII site (AGATCT), unless the target has no BglII sites. If the target has both sites, the design program gives up and doesn't prepend a restriction site to the -R2 primer!
Predicted Tm was obtained using the Tm determination tool at the Virtual Genome Center.
| Primer ID | Predicted Tm | sequence |
|---|---|---|
| 1689T-R10 | 63.50 | GGCGGTGGTGGCGGCATGGAAACGATTGAGCTTTACAAAAGCAG |
| 1689T-R11 | 65.60 | GTTCTTCTCCTTTGCGCCCCTACCAGTTGATAAATTTTTGGGTTTCAGC |
Note: This was generated using the standard codon usage table; UGA codons in MP/MP genes will show up as terminators ("*")
gaaacgattgagctttacaaaagcagcgttcctagtggtaaagaggcgggtaaaaatgcg E T I E L Y K S S V P S G K E A G K N A cttgctattaccaatcaacaactaatttcggctttagaaaatgctgcaaaagataataaa L A I T N Q Q L I S A L E N A A K D N K acctcccaaccacaagcacgatcacttacagcttctgatcaagttcaaattacacaaagt T S Q P Q A R S L T A S D Q V Q I T Q S tcagataaggttattggttacatcaccacatctaatttggacattgacaacaacaatacc S D K V I G Y I T T S N L D I D N N N T tttgatgttggtaagttaaacggtgataagtcaaccagcaaaatcattgttaacgctact F D V G K L N G D K S T S K I I V N A T ttaaaaaccttaaacaagatcaacaccttgcaaagcgaagagggcattattctgccccat L K T L N K I N T L Q S E E G I I L P H ccacaaaaatataagagtactgatccacaagctgtcgctaccgttcagggtccaagtatt P Q K Y K S T D P Q A V A T V Q G P S I attggtgttcatgctaacgctaaggaaaacgctgaaacccaaaaatttatcaactgg I G V H A N A K E N A E T Q K F I N W
ETIELYKSSVPSGKEAGKNALAITNQQLISALENAAKDNKTSQPQARSLTASDQVQITQSSDKVIGYITTSNLDIDNNNT FDVGKLNGDKSTSKIIVNATLKTLNKINTLQSEEGIILPHPQKYKSTDPQAVATVQGPSIIGVHANAKENAETQKFINW
This information was obtained using the Protein Parameters tool on the ExPASy Molecular Biology Server.
Number of amino acids: 159
Molecular weight: 17136.1
Theoretical pI: 7.03
Amino acid composition:
Ala (A) 14 8.8%
Arg (R) 1 0.6%
Asn (N) 15 9.4%
Asp (D) 8 5.0%
Cys (C) 0 0.0%
Gln (Q) 12 7.5%
Glu (E) 8 5.0%
Gly (G) 8 5.0%
His (H) 2 1.3%
Ile (I) 15 9.4%
Leu (L) 11 6.9%
Lys (K) 15 9.4%
Met (M) 0 0.0%
Phe (F) 2 1.3%
Pro (P) 6 3.8%
Ser (S) 15 9.4%
Thr (T) 15 9.4%
Trp (W) 1 0.6%
Tyr (Y) 3 1.9%
Val (V) 8 5.0%
Asx (B) 0 0.0%
Glx (Z) 0 0.0%
Xaa (X) 0 0.0%
Total number of negatively charged residues (Asp + Glu): 16
Total number of positively charged residues (Arg + Lys): 16
Atomic composition:
Carbon C 745
Hydrogen H 1219
Nitrogen N 209
Oxygen O 252
Sulfur S 0
Formula: C745H1219N209O252
Total number of atoms: 2425
Extinction coefficients:
Conditions: 6.0 M guanidium hydrochloride
0.02 M phosphate buffer
pH 6.5
Extinction coefficients are in units of M-1 cm-1 .
276 278 279 280 282
nm nm nm nm nm
Ext. coefficient 9750 9800 9695 9530 9200
Abs 0.1% (=1 g/l) 0.569 0.572 0.566 0.556 0.537
Estimated half-life:
The N-terminal of the sequence considered is E (Glu).
The estimated half-life is: 1 hours (mammalian reticulocytes, in vitro).
30 min (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Instability index:
The instability index (II) is computed to be 33.42
This classifies the protein as stable.
Aliphatic index: 87.17
Grand average of hydropathicity (GRAVY): -0.543