Berkeley Structural Genomics Center

Target info for 1009B

This target is gi number 4981384 from Thermotoga maritima.

This gene has the annotation "heat shock operon repressor HrcA".

The target was selected as part of Igor's sets.

Available sections:


Experimental status of 1009B

Note: Dates prior to 10/24/01 may be inaccurate, due to conversion from a record-keeping system which tracked only the last experimental date, to a new system which keeps track of all dates. The user is the person who entered the data, not the person who did the experiment. This will also change in the future.

ExperimentResultUserExperiment Date
SelectedDoneshkim2001-08-24
ClonedDoneabwaight2001-08-24
Expression testedDoneabwaight2001-08-24
Solubility testedSabwaight2001-08-24
PurifiedDoner_kim2003-08-06
CrystallizedDonedhshin2003-09-12
Diffraction quality crystalsDonedhshin2004-02-25
Native diffraction dataDonedhshin2004-02-25
Phasing diffraction dataDonedhshin2004-02-25
Traceable mapDonedhshin2004-02-25
Crystal structureDonedhshin2004-03-16
In PDB1STZdhshin2004-03-26

Back to Top


Potential MP Homologues of 1009B

MP genelog10(PSIBLAST E)% identical% coverage (of MP gene)
MP030 / MPN124-73.4017.8794.38

Back to Top


1009B DNA sequence

ATGAGAAGGCTCAACAGGAAGAACAACGAAGCCTTGAAGAAACTGAACGATCGTCAGAGAAAAGTGCTTTACTGCATCGT
GAGAGAGTACATAGAAAATAAAAAACCTGTGAGCTCACAGAGAGTTCTGGAAGTGAGCAATATAGAGTTCAGCAGTGCCA
CTATAAGAAATGATATGAAAAAATTGGAGTACCTTGGATACATATACCAGCCCCACACATCGGCTGGGAGGATTCCAACT
GACAAGGGGTTGAGATTTTACTACGAAGAAATGCTGAAAATCTCAAAAGAAACATCAGAAGCGGATCTCGCAGTGGAGAC
TTTCAAATCGATGCCTCTCGCTGATCCGGAAAAGGTTCTCTTCCTTGCGGGAAATCTTCTAGCTCGATTGACGGAAGGTT
ACGTCCTCATAGAAAGACCAAACACAAGAGATTTGAAAATACTCAGAGTGATGCTCATTCCTGTTTCGGAAGACTACCTC
ATTTTTTCCATATTGACGGAATTCGGTGTTTCCAAAGTTACTCCTATCAAAACTCAGGAACGACTGAACTGGGAAGAAAT
CGAAAGACAGCTCAACTTCCTCCTCAGAGGCAGAACAGTAGGAGAAGTGTTGATGGGTAAAATAGAAAGCCTGAAAGGAA
GTGGATTCCTCAGGTTGATTGAATCTCTGATAGGTGAGACTGTCGAGAGATATCTGGATGCAGGTCTTGAGAACCTTCTA
AAGGACGAAACGCTCACTCTGGAGGACATCAGAAACCTTCTCGAAGAAGTGAAGGATCAGAAATTTCTCGAGAGCTTAGT
TGGAGAAGGCATAACCGTCAGGATAGGAAGGGAAATCGGCAGAAAAAAGCTGGAAAAATTCGCCGTTTTTTCAGGGAAAT
ACTTTAAAGGAGAATCTCCTATCGGGAGTGTGTACCTCTTCACGTCGAAGGTTACGAAGTACGATAGAAATCACAGGGTG
TTTGAATACATTCTGAACCGTCTTTCAGAGTATTTCACTTCAACTTCCAGGAGGTGA

Back to Top


1009B Codon Usage

(339 codons)
fields: [triplet] [frequency: per thousand] ([number])

UUU17.7(   6)  UCU5.9(   2)  UAU5.9(   2)  UGU0.0(   0)  
UUC26.5(   9)  UCC8.8(   3)  UAC38.3(  13)  UGC2.9(   1)  
UUA2.9(   1)  UCA17.7(   6)  UAA0.0(   0)  UGA2.9(   1)  
UUG23.6(   8)  UCG11.8(   4)  UAG0.0(   0)  UGG2.9(   1)  

CUU23.6(   8)  CCU14.7(   5)  CAU0.0(   0)  CGU5.9(   2)  
CUC47.2(  16)  CCC2.9(   1)  CAC5.9(   2)  CGC0.0(   0)  
CUA5.9(   2)  CCA5.9(   2)  CAA0.0(   0)  CGA5.9(   2)  
CUG29.5(  10)  CCG2.9(   1)  CAG17.7(   6)  CGG0.0(   0)  

AUU14.7(   5)  ACU26.5(   9)  AAU14.7(   5)  AGU8.8(   3)  
AUC20.6(   7)  ACC2.9(   1)  AAC29.5(  10)  AGC14.7(   5)  
AUA32.4(  11)  ACA11.8(   4)  AAA56.0(  19)  AGA47.2(  16)  
AUG17.7(   6)  ACG14.7(   5)  AAG26.5(   9)  AGG26.5(   9)  

GUU23.6(   8)  GCU8.8(   3)  GAU23.6(   8)  GGU14.7(   5)  
GUC8.8(   3)  GCC8.8(   3)  GAC11.8(   4)  GGC8.8(   3)  
GUA2.9(   1)  GCA5.9(   2)  GAA79.6(  27)  GGA23.6(   8)  
GUG29.5(  10)  GCG5.9(   2)  GAG29.5(  10)  GGG11.8(   4)  

Back to Top


1009B Potential Cloning Problems

No UGA codons or (bad) restriction sites!

Back to Top


1009B Automatically Selected Primers

Note: These were generated using Hisao's algorithm, and do not take into account possible mispriming, self-complementarity, or requirements for mutations anywhere in the sequences. The -R1 primers are for the N-terminal end, and begin with an NdeI restriction site (CATATG). The -R2 primers are for the C-terminal end, and begin with a BamHI site (GGATCC) if the target has no other BamHI sites. If the target does have a BamHI site, the -R2 primer wil begin with a BglII site (AGATCT), unless the target has no BglII sites. If the target has both sites, the design program gives up and doesn't prepend a restriction site to the -R2 primer!

Predicted Tm was obtained using the Tm determination tool at the Virtual Genome Center.

Primer IDPredicted Tmsequence
1009B-R160.20CATATGAGAAGGCTCAACAGGAAGA
1009B-R260.80GGATCCTTATCACCTCCAAGTTGAAGTGAAATAC
1009B-R360.00GGATCCTTACCTCCTGGAAGTTGAAGTGAA
1009B-R1064.60GGCGGTGGTGGCGGCATGAGAAGGCTCAACAGGAAGAACA
1009B-R1164.20GTTCTTCTCCTTTGCGCCCCTACCTCCTGGAAGTTGAAGTGAAATACTC

Back to Top


1009B Translation

Note: This was generated using the standard codon usage table; UGA codons in MP/MP genes will show up as terminators ("*")

atgagaaggctcaacaggaagaacaacgaagccttgaagaaactgaacgatcgtcagaga
 M  R  R  L  N  R  K  N  N  E  A  L  K  K  L  N  D  R  Q  R 
aaagtgctttactgcatcgtgagagagtacatagaaaataaaaaacctgtgagctcacag
 K  V  L  Y  C  I  V  R  E  Y  I  E  N  K  K  P  V  S  S  Q 
agagttctggaagtgagcaatatagagttcagcagtgccactataagaaatgatatgaaa
 R  V  L  E  V  S  N  I  E  F  S  S  A  T  I  R  N  D  M  K 
aaattggagtaccttggatacatataccagccccacacatcggctgggaggattccaact
 K  L  E  Y  L  G  Y  I  Y  Q  P  H  T  S  A  G  R  I  P  T 
gacaaggggttgagattttactacgaagaaatgctgaaaatctcaaaagaaacatcagaa
 D  K  G  L  R  F  Y  Y  E  E  M  L  K  I  S  K  E  T  S  E 
gcggatctcgcagtggagactttcaaatcgatgcctctcgctgatccggaaaaggttctc
 A  D  L  A  V  E  T  F  K  S  M  P  L  A  D  P  E  K  V  L 
ttccttgcgggaaatcttctagctcgattgacggaaggttacgtcctcatagaaagacca
 F  L  A  G  N  L  L  A  R  L  T  E  G  Y  V  L  I  E  R  P 
aacacaagagatttgaaaatactcagagtgatgctcattcctgtttcggaagactacctc
 N  T  R  D  L  K  I  L  R  V  M  L  I  P  V  S  E  D  Y  L 
attttttccatattgacggaattcggtgtttccaaagttactcctatcaaaactcaggaa
 I  F  S  I  L  T  E  F  G  V  S  K  V  T  P  I  K  T  Q  E 
cgactgaactgggaagaaatcgaaagacagctcaacttcctcctcagaggcagaacagta
 R  L  N  W  E  E  I  E  R  Q  L  N  F  L  L  R  G  R  T  V 
ggagaagtgttgatgggtaaaatagaaagcctgaaaggaagtggattcctcaggttgatt
 G  E  V  L  M  G  K  I  E  S  L  K  G  S  G  F  L  R  L  I 
gaatctctgataggtgagactgtcgagagatatctggatgcaggtcttgagaaccttcta
 E  S  L  I  G  E  T  V  E  R  Y  L  D  A  G  L  E  N  L  L 
aaggacgaaacgctcactctggaggacatcagaaaccttctcgaagaagtgaaggatcag
 K  D  E  T  L  T  L  E  D  I  R  N  L  L  E  E  V  K  D  Q 
aaatttctcgagagcttagttggagaaggcataaccgtcaggataggaagggaaatcggc
 K  F  L  E  S  L  V  G  E  G  I  T  V  R  I  G  R  E  I  G 
agaaaaaagctggaaaaattcgccgttttttcagggaaatactttaaaggagaatctcct
 R  K  K  L  E  K  F  A  V  F  S  G  K  Y  F  K  G  E  S  P 
atcgggagtgtgtacctcttcacgtcgaaggttacgaagtacgatagaaatcacagggtg
 I  G  S  V  Y  L  F  T  S  K  V  T  K  Y  D  R  N  H  R  V 
tttgaatacattctgaaccgtctttcagagtatttcacttcaacttccaggaggtga
 F  E  Y  I  L  N  R  L  S  E  Y  F  T  S  T  S  R  R  * 

Back to Top


1009B AA Sequence

MRRLNRKNNEALKKLNDRQRKVLYCIVREYIENKKPVSSQRVLEVSNIEFSSATIRNDMKKLEYLGYIYQPHTSAGRIPT
DKGLRFYYEEMLKISKETSEADLAVETFKSMPLADPEKVLFLAGNLLARLTEGYVLIERPNTRDLKILRVMLIPVSEDYL
IFSILTEFGVSKVTPIKTQERLNWEEIERQLNFLLRGRTVGEVLMGKIESLKGSGFLRLIESLIGETVERYLDAGLENLL
KDETLTLEDIRNLLEEVKDQKFLESLVGEGITVRIGREIGRKKLEKFAVFSGKYFKGESPIGSVYLFTSKVTKYDRNHRV
FEYILNRLSEYFTSTSRR

Back to Top


1009B Protein Parameters

This information was obtained using the Protein Parameters tool on the ExPASy Molecular Biology Server.

Number of amino acids: 338

Molecular weight: 39306.5

Theoretical pI: 9.24

Amino acid composition:

Ala (A)  10	  3.0%
Arg (R)  29	  8.6%
Asn (N)  15	  4.4%
Asp (D)  12	  3.6%
Cys (C)   1	  0.3%
Gln (Q)   6	  1.8%
Glu (E)  37	 10.9%
Gly (G)  20	  5.9%
His (H)   2	  0.6%
Ile (I)  23	  6.8%
Leu (L)  45	 13.3%
Lys (K)  28	  8.3%
Met (M)   6	  1.8%
Phe (F)  15	  4.4%
Pro (P)   9	  2.7%
Ser (S)  23	  6.8%
Thr (T)  19	  5.6%
Trp (W)   1	  0.3%
Tyr (Y)  15	  4.4%
Val (V)  22	  6.5%

Asx (B)   0	  0.0%
Glx (Z)   0	  0.0%
Xaa (X)   0	  0.0%

Total number of negatively charged residues (Asp + Glu): 49
Total number of positively charged residues (Arg + Lys): 57

Atomic composition:

Carbon      C	      1769
Hydrogen    H	      2863
Nitrogen    N	       479
Oxygen      O	       515
Sulfur      S	         7

Formula: C1769H2863N479O515S7
Total number of atoms: 5633

Extinction coefficients:

Conditions: 6.0 M guanidium hydrochloride
            0.02 M phosphate buffer
            pH 6.5

Extinction coefficients are in units of  M-1 cm-1 .

The first table lists values computed assuming ALL Cys 
residues appear as half cystines, whereas the second table 
assumes that NONE do. 

                      276     278     279     280     282
                       nm      nm      nm      nm      nm
Ext. coefficient    27150   26600   25835   24890   23600
Abs 0.1% (=1 g/l)   0.691   0.677   0.657   0.633   0.600



                      276     278     279     280     282
                       nm      nm      nm      nm      nm
Ext. coefficient    27150   26600   25835   24890   23600
Abs 0.1% (=1 g/l)   0.691   0.677   0.657   0.633   0.600


Estimated half-life:

The N-terminal of the sequence considered is M (Met).

The estimated half-life is: 30 hours (mammalian reticulocytes, in vitro).
                            >20 hours (yeast, in vivo).
                            >10 hours (Escherichia coli, in vivo).


Instability index:

The instability index (II) is computed to be 36.74
This classifies the protein as stable.



Aliphatic index: 100.30

Grand average of hydropathicity (GRAVY): -0.369

Back to Top